DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prp31 and AT1G70400

DIOPT Version :9

Sequence 1:NP_648756.1 Gene:Prp31 / 39655 FlyBaseID:FBgn0036487 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001154463.1 Gene:AT1G70400 / 843376 AraportID:AT1G70400 Length:274 Species:Arabidopsis thaliana


Alignment Length:162 Identity:60/162 - (37%)
Similarity:93/162 - (57%) Gaps:15/162 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VTVQSVRELCKLRDSERLKNTLQQIEHYASRQRTAAEMLGSVESDPEY-CLIVDANAIAVDIDNE 114
            :|...:..:.||:.|.|..:.:||:|.       |.|  |||   .|| .||||...:.|||:||
plant     9 LTYDDLDSVSKLQKSRRYADIMQQVEE-------ALE--GSV---LEYKKLIVDCKQLLVDIENE 61

  Fly   115 ISIVHKFTKEKYQKRFPELDSLIVGEIEYLLAVKELGNDLDQVKNNEKLQAILTQATIMIVSVTA 179
            |.||..|.::||:.:|.||:.|:...|:|...||.:||::| :|..: |:.:|..|.||::.|||
plant    62 IVIVQNFIRDKYRVKFQELELLVPHPIDYARVVKRIGNEMD-LKLVD-LEGLLPSAMIMVLLVTA 124

  Fly   180 STTQGTMLTPAEKAKIDEACEMAIELNNFKSK 211
            .||:|..|......|..:||:.|::|::.:.|
plant   125 LTTKGNQLPEDVLLKTIDACDRALDLDSARKK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prp31NP_648756.1 NOSIC 101..152 CDD:197999 22/50 (44%)
Nop 107..337 CDD:280047 41/105 (39%)
Prp31_C 345..472 CDD:286825
AT1G70400NP_001154463.1 NOSIC 48..99 CDD:197999 22/50 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1498
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D791296at2759
OrthoFinder 1 1.000 - - FOG0004373
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13904
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.