DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prp31 and NOP56

DIOPT Version :9

Sequence 1:NP_648756.1 Gene:Prp31 / 39655 FlyBaseID:FBgn0036487 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_006383.2 Gene:NOP56 / 10528 HGNCID:15911 Length:594 Species:Homo sapiens


Alignment Length:418 Identity:99/418 - (23%)
Similarity:186/418 - (44%) Gaps:53/418 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LIVDANAIAVDIDNEISIVHKFTKEKYQKRFPELDSLIVGEIEYLLAVKELGN--DLDQVKNNEK 162
            :|:.:.::...:|.:|:......:|.|...||||..:|.....|....:.:||  :|::.| .||
Human   167 MIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIINDNATYCRLAQFIGNRRELNEDK-LEK 230

  Fly   163 LQAI-LTQATIMIVSVTASTTQGTMLTPAEKAKIDEACEMAIELNNFKSKIYEYVESRMTFIAPN 226
            |:.: :..|....:...:.::.|..::..:...|:......:.|:.::..::.|:.|:|:.:||:
Human   231 LEELTMDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPS 295

  Fly   227 LSMIVGASTAAKLLGIAGGLSKLSKMPACNVQVLGAQKKTLSGFSQTQMLPHTGYVYYSQIVQDT 291
            ||.::|.:..|:|:..||.|:.|:|.||..||:|||:|............|..|.:::|..:...
Human   296 LSALIGEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRA 360

  Fly   292 APDLRRKAARLVAAKSVLAARVDACHE---SVHGEIGLRFKEDVE-------------KKLDKLQ 340
            |...:.:.:|.:|.|..:|:|:|...|   ||.||   :.:|.||             |.||.::
Human   361 AAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGE---KLREQVEERLSFYETGEIPRKNLDVMK 422

  Fly   341 EPPPVKFIKPLPKPIEGSKK--KRGGKRVRKMKERYALTEFRKQANRMNFGDIEEDAYQGDLGYS 403
            |    ..::......|.::|  |:..||::|.|:|.|....   |:..|.....|:..:    .|
Human   423 E----AMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALAL---ASSENSSSTPEECEE----MS 476

  Fly   404 RGTIGKTGTGRIRLPQVD--EKTKVRISKTLHKNLQKQQVYGGNTTVKRQISGTASSVAF----- 461
            .....|.......:||.:  |...:..||.     :|::.:.....:...:..||.|.:.     
Human   477 EKPKKKKKQKPQEVPQENGMEDPSISFSKP-----KKKKSFSKEELMSSDLEETAGSTSIPKRKK 536

  Fly   462 -TPLQGLEIVN--PQAAERSQTEANAKY 486
             ||.:  |.||  .:|..||.::...|:
Human   537 STPKE--ETVNDPEEAGHRSGSKKKRKF 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prp31NP_648756.1 NOSIC 101..152 CDD:197999 11/50 (22%)
Nop 107..337 CDD:280047 63/248 (25%)
Prp31_C 345..472 CDD:286825 28/138 (20%)
NOP56NP_006383.2 NOP5NT 5..70 CDD:285382
NOSIC 168..219 CDD:197999 11/50 (22%)
Nop 174..405 CDD:280047 62/234 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 458..594 23/119 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1498
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.