DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTA and FUT12

DIOPT Version :9

Sequence 1:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_175393.1 Gene:FUT12 / 841394 AraportID:AT1G49710 Length:513 Species:Arabidopsis thaliana


Alignment Length:301 Identity:82/301 - (27%)
Similarity:120/301 - (39%) Gaps:72/301 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LECPYHTQNVKVPDAINWTATYRRDSTIVAPYEKWQYYDTKVQQQEQDINYSVNKTKKV------ 304
            ::|.:...:.|.|||...........:|:...|..|||......|.:...|.:..|..:      
plant   137 VDCTFGDSSGKTPDAAFGLGQKPGTLSIIRSMESAQYYPENDLAQARRRGYDIVMTTSLSSDVPV 201

  Fly   305 ---AW--------------------FVSNCGARNGRLQYAHELQK-YIEVDIYGACGNFKCSRST 345
               :|                    |:|||||||.|||....|.| .|::|.||.|...:..:  
plant   202 GYFSWAEYDIMSPVQPKTERAIAAAFISNCGARNFRLQALEALMKTNIKIDSYGGCHRNRDGK-- 264

  Fly   346 ADKCFEILDNDYKFYLAFENSNCKDYITEKFFVNALNRRVLPIVMGARPEDYEVSAPRR-SYIHV 409
            .|| .|.|.. |||.|||||:|.:||:||||| .:|....:|:|:|  |.:.|..||.. |::|:
plant   265 VDK-VEALKR-YKFSLAFENTNEEDYVTEKFF-QSLVAGSVPVVVG--PPNIEEFAPASDSFLHI 324

  Fly   410 DEFSSPKELAEYLRILDHDDELYNSYFKWKGTG---------EFINTYYWCRVC---ATLHNEEQ 462
            ......:.:|:.::.|..:...||...:||..|         :....:..||:|   ||...|::
plant   325 KTMEDVEPVAKRMKYLAANPAAYNQTLRWKYEGPSDSFKALVDMAAVHSSCRLCIFLATRVREQE 389

  Fly   463 LRKPRWYTDLNDWWRGPGVCTTRSWRNFKARKDVISDSSDD 503
            ...|                      |||.|....|....|
plant   390 EESP----------------------NFKKRPCKCSRGGSD 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 6/30 (20%)
Glyco_transf_10 300..473 CDD:279224 64/215 (30%)
FUT12NP_175393.1 Glyco_transf_10 224..388 CDD:279224 60/170 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2794
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D551308at2759
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - otm3143
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X114
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.