DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTA and fut9a

DIOPT Version :9

Sequence 1:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001122265.1 Gene:fut9a / 796410 ZFINID:ZDB-GENE-080723-75 Length:359 Species:Danio rerio


Alignment Length:298 Identity:102/298 - (34%)
Similarity:152/298 - (51%) Gaps:47/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 VDTCELTANRDLASTADMILYKDHYIPTGIR------RPSNSKQVSMLYYLECPYHTQNVK-VPD 259
            :|.|.:||:|:|.:.:|.::.....|.:.:.      ||:..:.:.|.:  |.|.|:..:. :.:
Zfish    88 IDGCFVTADRNLYNKSDAVVIHHRDITSDLSNMPPAYRPTLQRWIWMNF--ESPSHSSQLPGIEN 150

  Fly   260 AINWTATYRRDSTIVAPYEKWQYYDTKVQQQEQDINYSVNKTKKVAWFVSNCGARNGRLQYAHEL 324
            ..|.|..||:|:.|..||.     .....|.|:|. ...:|||.:.|.|||....:.|::|.:||
Zfish   151 LFNLTLNYRQDADIEVPYG
-----SIVAAQGEEDF-VPPSKTKLICWIVSNWNPDHVRVKYYNEL 209

  Fly   325 QKYIEVDIYG-ACGNFKCSRSTADKCFEILDNDY-------KFYLAFENSNCKDYITEKFFVNAL 381
            .|:|||..|| |.|.:            |.|.||       |||||||||..|||||||.: |.|
Zfish   210 YKHIEVHAYGQAFGEY------------ISDQDYFPTIASCKFYLAFENSIHKDYITEKLY-NPL 261

  Fly   382 NRRVLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFKWKGTGEFIN 446
            :...:|:|:|...|:|:......::||||:|.||||||:||..||.::|||..||:|:...:...
Zfish   262 SVGTVPVVLGPPRENYQNFVQGNAFIHVDDFPSPKELADYLLFLDKNEELYLKYFEWRKHFKVKK 326

  Fly   447 TYYW----CRVC--ATLHNEEQLRKPRWYTDLNDWWRG 478
            .|:|    |..|  ...|||.:.     ..:|:.|:.|
Zfish   327 AYFWAEHTCLACDYVRRHNEYKA-----INNLDKWYWG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 20/81 (25%)
Glyco_transf_10 300..473 CDD:279224 74/186 (40%)
fut9aNP_001122265.1 Glyco_tran_10_N 61..169 CDD:293644 21/82 (26%)
Glyco_transf_10 185..353 CDD:279224 74/185 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5509
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4419
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - mtm6372
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3232
SonicParanoid 1 1.000 - - X114
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.960

Return to query results.
Submit another query.