DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTA and fut9

DIOPT Version :9

Sequence 1:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_031757540.1 Gene:fut9 / 548391 XenbaseID:XB-GENE-966137 Length:368 Species:Xenopus tropicalis


Alignment Length:370 Identity:116/370 - (31%)
Similarity:170/370 - (45%) Gaps:64/370 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 YPKPAKTYSNRKARKRHAPRLLPHQDPYSDRIINQLMYVPHNYEEIKSSGKLKTILLYNGLGPWN 187
            |.||...:.:......|:  :|..::.:|.:         .||..       :|::|.     |.
 Frog    38 YVKPTNNWISSPIESAHS--VLKMKNFFSSK---------QNYYN-------ETVVLI-----WV 79

  Fly   188 VKKGRDVFLKAKCP----VDTCELTANRDLASTADMILYKDHYIPTGIR------RPSNSKQVSM 242
            ...|:...||: |.    :..|.||.:|.|.:.:..:|.....|...:.      ||...|.:.|
 Frog    80 WPFGQTFELKS-CQTLFNIHGCHLTTDRTLYNKSHAVLIHHRDISWDLTNLPLQLRPPFQKWIWM 143

  Fly   243 LYYLECPYHT-QNVKVPDAINWTATYRRDSTIVAPYEKWQYYDTKVQQQEQDINYSVNKTKKVAW 306
              .||.|.|| |...:....|.|.||||||.|..|| .:....||..:.|..     :|.|.|.|
 Frog   144 --NLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPY-GFMVVSTKPFEFEVP-----SKDKFVCW 200

  Fly   307 FVSNCGARNGRLQYAHELQKYIEVDIYG-ACGNFKCSRS---TADKCFEILDNDYKFYLAFENSN 367
            .|||....:.|::|.:||.||||:..|| |.|.:...:|   |...|        ||||:||||.
 Frog   201 VVSNWNPEHARVKYYNELNKYIEIITYGQAFGEYLSDKSLLPTISSC--------KFYLSFENSI 257

  Fly   368 CKDYITEKFFVNALNRRVLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELY 432
            .|||||||.: |||....:|||:|...|:||...|..|:|||::|.||:||:::|.:|:.|.|.|
 Frog   258 HKDYITEKLY-NALLAGSVPIVLGPPRENYENYIPADSFIHVEDFLSPRELSDHLLMLNKDTEQY 321

  Fly   433 NSYFKWKGTGEFINTYYW----CRVCATLHNEEQLRK----PRWY 469
            .|||.|:........::|    |..|..:...::.:.    .:|:
 Frog   322 LSYFNWRKHFTVSMPHFWESHACLACDHVKRHQEYKSVGNLEKWF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 33/114 (29%)
Glyco_transf_10 300..473 CDD:279224 70/182 (38%)
fut9XP_031757540.1 Glyco_tran_10_N 71..178 CDD:407214 35/122 (29%)
Glyco_transf_10 194..363 CDD:395683 69/177 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4795
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4141
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - otm48010
Panther 1 1.100 - - O PTHR11929
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X114
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.