DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTA and fut4

DIOPT Version :9

Sequence 1:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001004773.1 Gene:fut4 / 447974 XenbaseID:XB-GENE-979293 Length:363 Species:Xenopus tropicalis


Alignment Length:290 Identity:108/290 - (37%)
Similarity:149/290 - (51%) Gaps:36/290 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 VDTCELTANRDLASTADMILYKDHY--------IPTGIRRPSNSKQVSMLYYLECPYHTQ-NVKV 257
            |..|.:|.||.|...||.|::  |:        :|.. ||.|:.|.:.|.:  |.|.|:. ...:
 Frog    93 VTGCHITTNRSLYQEADAIVF--HHRDIADFSDLPFR-RRQSSQKWIWMNF--ESPSHSPWLASL 152

  Fly   258 PDAINWTATYRRDSTIVAPYE-KWQYYDTKVQQQEQDINYSVNKTKKVAWFVSNCGARNGRLQYA 321
            ....|||.:||.||.|..||. .:.....|:        ....|.|.|||.:||....:.|:||.
 Frog   153 GGIFNWTMSYRVDSDIFMPYG
FLFSKKHAKI--------VLPRKRKLVAWVISNWNEDHERVQYY 209

  Fly   322 HELQKYIEVDIYGACG-NFKCSRSTADKCFEILDNDYKFYLAFENSNCKDYITEKFFVNALNRRV 385
            :||:.||::||||..| :.|     .|...:.: ::||||||||||...||||||.:.||.....
 Frog   210 NELRNYIQIDIYGRYGLDLK-----EDNIIKTV-SEYKFYLAFENSLHTDYITEKLWRNAFKSNA 268

  Fly   386 LPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFKWKGTGEFINTYYW 450
            :|||||....:||:..||.|:||||:||||::||.||:.||.:..||..||.||...:...|.:|
 Frog   269 IPIVMGPSRHNYEMFIPRNSFIHVDDFSSPRKLAMYLKHLDKNTHLYRRYFTWKKRYDVHVTSFW 333

  Fly   451 ----CRVCATLHNEEQLRKPRWYTDLNDWW 476
                |..|.::......|  |..:||..|:
 Frog   334 DEHYCTACQSVKAAGNQR--RTASDLAGWF 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 27/83 (33%)
Glyco_transf_10 300..473 CDD:279224 76/177 (43%)
fut4NP_001004773.1 Glyco_tran_10_N 66..173 CDD:374959 28/84 (33%)
Glyco_transf_10 188..358 CDD:366335 76/177 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4795
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4141
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - otm48010
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3232
SonicParanoid 1 1.000 - - X114
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.