DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTA and Fut7

DIOPT Version :9

Sequence 1:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_006233647.1 Gene:Fut7 / 296564 RGDID:735019 Length:380 Species:Rattus norvegicus


Alignment Length:283 Identity:86/283 - (30%)
Similarity:139/283 - (49%) Gaps:25/283 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 TCELTANRDLASTADMILYKDHYIPT-GIRRPSNSK---QVSMLYYLECPYHTQNVK-VPDAINW 263
            :|.|:|||.|.::||.:::....:.| ..|.|.:.:   |..:...:|.|.:|..:: .....||
  Rat   113 SCHLSANRSLLASADAVVFHHRELQTRHSRLPLDQRPHGQPWVWATMESPSNTHGLRHFRGIFNW 177

  Fly   264 TATYRRDSTIVAPYEKWQYYDTKVQQQEQDINYSVNKTKKVAWFVSNCGARNGRLQYAHELQKYI 328
            ..:|||||.|..||.:.:.:.........       |::..||.|||...|..|.:...:|..::
  Rat   178 VLSYRRDSDIFVPYG
RLEPFSGPTPPLPA-------KSRMAAWVVSNFQERQQRAKLYRQLAPHL 235

  Fly   329 EVDIYGACGNFKCSRSTADKCFEILDNDYKFYLAFENSNCKDYITEKFFVNALNRRVLPIVMGAR 393
            :||::|...    .|.....|.......|:|||:||||..:|||||||:.|||....:|:|:|..
  Rat   236 KVDVFGRAS----GRPLCPNCLLPTVARYRFYLSFENSQHRDYITEKFWRNALAAGAVPVVLGPP 296

  Fly   394 PEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFKWKG--TGEFINTY--YWCRVC 454
            ...||...|..::||||:|||.:|||.:|  :..::..|..:|.|:.  ....:|.:  .:|.:|
  Rat   297 RTTYEAFVPPDAFIHVDDFSSARELAVFL--VSMNESRYRGFFAWRDRLRVRLLNDWRERFCTIC 359

  Fly   455 ATLHNEEQLRKPRWYTDLNDWWR 477
            |   ....|.:.:.|.||..|::
  Rat   360 A---RYPYLPRSQVYEDLESWFQ 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 23/77 (30%)
Glyco_transf_10 300..473 CDD:279224 59/176 (34%)
Fut7XP_006233647.1 Glyco_tran_10_N 82..192 CDD:293644 24/78 (31%)
Glyco_transf_10 207..375 CDD:279224 59/176 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6097
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - mtm8988
orthoMCL 1 0.900 - - OOG6_100170
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X114
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.