DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTA and FUT6

DIOPT Version :9

Sequence 1:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_000141.1 Gene:FUT6 / 2528 HGNCID:4017 Length:359 Species:Homo sapiens


Alignment Length:285 Identity:104/285 - (36%)
Similarity:141/285 - (49%) Gaps:34/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 CELTANRDLASTADMILYKDH---YIPTG--IRRPSNSKQVSMLYYLECPYHTQNVKVPDA-INW 263
            |.:||:|.:...||.::....   |.|:.  .|.|....|..:.:.:|.|.|...:|..|. .|.
Human    90 CNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQLKAMDGYFNL 154

  Fly   264 TATYRRDSTIVAPY---EKWQYYDTKVQQQEQDINYSVNKTKKVAWFVSNCGARNGRLQYAHELQ 325
            |.:||.||.|..||   |.|     ..|.....:|.|. ||:.|||.|||.|..:.|::|...||
Human   155 TMSYRSDSDIFTPYG
WLEPW-----SGQPAHPPLNLSA-KTELVAWAVSNWGPNSARVRYYQSLQ 213

  Fly   326 KYIEVDIYGACGNFKCSRS----TADKCFEILDNDYKFYLAFENSNCKDYITEKFFVNALNRRVL 386
            .:::||:||        ||    ......|.|.. ||||||||||...||||||.:.|||....:
Human   214 AHLKVDVYG--------RSHKPLPQGTMMETLSR-YKFYLAFENSLHPDYITEKLWRNALEAWAV 269

  Fly   387 PIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFKWKGT---GEFINTY 448
            |:|:|....:||...|..::||||:|.|||:||.||:.||.|...|.|||:|:.|   ..|....
Human   270 PVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWAL 334

  Fly   449 YWCRVCATLHNEEQLRK---PRWYT 470
            .:|:.|..|..|.:.:.   ..|:|
Human   335 AFCKACWKLQEESRYQTRGIAAWFT 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 23/77 (30%)
Glyco_transf_10 300..473 CDD:279224 74/181 (41%)
FUT6NP_000141.1 Glyco_tran_10_N 62..169 CDD:407214 24/78 (31%)
determines site-specific fucosylation. /evidence=ECO:0000269|PubMed:17604274 73..112 6/21 (29%)
Glyco_transf_10 188..351 CDD:395683 72/171 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5576
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34780
Inparanoid 1 1.050 148 1.000 Inparanoid score I4402
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - mtm8516
orthoMCL 1 0.900 - - OOG6_100170
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X114
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.