DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTA and FUT5

DIOPT Version :9

Sequence 1:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_002025.2 Gene:FUT5 / 2527 HGNCID:4016 Length:374 Species:Homo sapiens


Alignment Length:289 Identity:101/289 - (34%)
Similarity:141/289 - (48%) Gaps:41/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 CELTANRDLASTADMILYKDHYI----------PTGIRRPSNSKQVSMLYYLECPYHTQNVKVPD 259
            |.:||:..:...||.::.....|          ||   ||...:.:  .:.:|.|.:.::::..|
Human   104 CNITADSSVYPQADAVIVHHWDIMYNPSANLPPPT---RPQGQRWI--WFSMESPSNCRHLEALD 163

  Fly   260 A-INWTATYRRDSTIVAPY---EKWQYYDTKVQQQEQDINYSVNKTKKVAWFVSNCGARNGRLQY 320
            . .|.|.:||.||.|..||   |.|     ..|.....:|.|. ||:.|||.|||....:.|::|
Human   164 GYFNLTMSYRSDSDIFTPYG
WLEPW-----SGQPAHPPLNLSA-KTELVAWAVSNWKPDSARVRY 222

  Fly   321 AHELQKYIEVDIYGACGNFKCSRSTADK--CFEILDNDYKFYLAFENSNCKDYITEKFFVNALNR 383
            ...||.:::||:||.      |.....|  ..|.|.. ||||||||||...||||||.:.|||..
Human   223 YQSLQAHLKVDVYGR------SHKPLPKGTMMETLSR-YKFYLAFENSLHPDYITEKLWRNALEA 280

  Fly   384 RVLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFKWKGT---GEFI 445
            ..:|:|:|....:||...|..::||||:|.|||:||.||:.||.|...|.|||.|:.|   ..|.
Human   281 WAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFHWRETLRPRSFS 345

  Fly   446 NTYYWCRVCATLHNEEQLRKPR----WYT 470
            ....:|:.|..|..|.:.:..|    |:|
Human   346 WALAFCKACWKLQQESRYQTVRSIAAWFT 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 20/82 (24%)
Glyco_transf_10 300..473 CDD:279224 74/180 (41%)
FUT5NP_002025.2 Glyco_tran_10_N 73..183 CDD:293644 21/83 (25%)
Glyco_transf_10 202..370 CDD:279224 72/174 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5576
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I4402
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - mtm8516
orthoMCL 1 0.900 - - OOG6_100170
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3232
SonicParanoid 1 1.000 - - X114
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.