DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTA and fut-6

DIOPT Version :9

Sequence 1:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_494823.2 Gene:fut-6 / 188084 WormBaseID:WBGene00020222 Length:392 Species:Caenorhabditis elegans


Alignment Length:325 Identity:106/325 - (32%)
Similarity:158/325 - (48%) Gaps:61/325 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 AKCP--VDTCELTANRDLASTADMILYKD-HYIPTGIRRPSNSKQVSM-----------LYYLEC 248
            |.||  .:.|.:|........||.:|:.: .|      |.|..|...|           |:.||.
 Worm    86 ATCPDVQNYCRITQEESEFDNADAVLFHNADY------RGSTDKFKKMKSQRKPGVPYVLWSLES 144

  Fly   249 PYHTQNVKVPDA--INWTATYRRDSTIVAPYEKWQYYDTKVQQQ---EQDIN-YSVNKTKKVAWF 307
            |  |.::..||:  ||||.|||.||.:.||      |.|.|:.:   |.|:| ....|||...|.
 Worm   145 P--TNDMFRPDSHMINWTMTYRTDSDVWAP------YG
TIVKLKNPVEVDLNAIWEGKTKTATWL 201

  Fly   308 VSNCGARNGRLQYAHELQKYI----EVDIYGACGNFKCSRSTADK----CFEILDNDYKFYLAFE 364
            .|||..:|.|...   ::|.|    |:||:|.||......:..|.    |...|...||||::.|
 Worm   202 ASNCITQNHRFDL---IKKIIDNGFEIDIWGNCGKQVSQCAGVDNQESPCVLELIKPYKFYISME 263

  Fly   365 NSNCKDYITEKFFVNALN-RRVLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHD 428
            |||||||:||||: .||| |..:|||: ||....::..|..:||.||::::..|...:::.::.:
 Worm   264 NSNCKDYVTEKFW-KALNDRMTIPIVL-ARKYYKDLGVPDSAYIAVDDYATLDEFLAHVKKVNKE 326

  Fly   429 DELYNSYFKWK-------GTGEFINTYYWCRVCATLHNEEQ-LRKPRWYTDLNDWWRGPGVCTTR 485
            .:|:.||.:|:       |:| |..   ||.:|..|.:::. |:.|:.|.|: .||....:|..:
 Worm   327 KDLFLSYHQWRKEWKVIIGSG-FSG---WCTLCNKLQDKDYILKNPKSYKDV-AWWHSFEMCNNQ 386

  Fly   486  485
             Worm   387  386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 30/94 (32%)
Glyco_transf_10 300..473 CDD:279224 66/189 (35%)
fut-6NP_494823.2 Glyco_tran_10_N 64..174 CDD:293644 31/101 (31%)
Glyco_transf_10 194..375 CDD:279224 66/190 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I8094
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I2946
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - otm14119
orthoMCL 1 0.900 - - OOG6_100170
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3232
SonicParanoid 1 1.000 - - X114
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.