DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTA and Fut9

DIOPT Version :9

Sequence 1:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_034373.1 Gene:Fut9 / 14348 MGIID:1330859 Length:359 Species:Mus musculus


Alignment Length:295 Identity:97/295 - (32%)
Similarity:138/295 - (46%) Gaps:52/295 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 VDTCELTANRDLASTADMILYKDHYIPTGI------RRPSNSKQVSMLYYLECPYHT-QNVKVPD 259
            :..|.||.:|.|.:.:..:|.....|...:      .||...|.:.|  .||.|.|| |...:..
Mouse    88 IQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWM--NLESPTHTPQKSGIEH 150

  Fly   260 AINWTATYRRDSTIVAPYEKWQYYDTKVQQQEQDINYSVN--------KTKKVAWFVSNCGARNG 316
            ..|.|.||||||.|..||              ..:..|.|        |.|.|.|.|||....:.
Mouse   151 LFNLTLTYRRDSDIQVPY--------------G
FLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHA 201

  Fly   317 RLQYAHELQKYIEVDIYG-ACGNFKCSRS---TADKCFEILDNDYKFYLAFENSNCKDYITEKFF 377
            |::|.:||.|.||:..|| |.|.:...::   |...|        ||||:||||..|||||||.:
Mouse   202 RVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTC--------KFYLSFENSIHKDYITEKLY 258

  Fly   378 VNALNRRVLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFKWKGTG 442
             ||.....:|:|:|...|:||...|..|:|||::|:||.|||:||:.:|.:::||.|||.|:...
Mouse   259 -NAFLAGSVPVVLGPSRENYENYIPADSFIHVEDFNSPSELAKYLKEVDKNNKLYLSYFNWRKDF 322

  Fly   443 EFINTYYW----CRVCATLHNEEQLRK----PRWY 469
            ......:|    |..|..:...::.:.    .:|:
Mouse   323 TVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWF 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 26/81 (32%)
Glyco_transf_10 300..473 CDD:279224 67/182 (37%)
Fut9NP_034373.1 Glyco_tran_10_N 62..169 CDD:293644 28/96 (29%)
Glyco_transf_10 185..354 CDD:279224 66/177 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6052
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6520
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - mtm8745
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3232
SonicParanoid 1 1.000 - - X114
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.