DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTA and Fut7

DIOPT Version :9

Sequence 1:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_011237324.1 Gene:Fut7 / 14347 MGIID:107692 Length:438 Species:Mus musculus


Alignment Length:306 Identity:91/306 - (29%)
Similarity:143/306 - (46%) Gaps:57/306 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 PVDT--------CELTANRDLASTADMILYKDHYIPTG------IRRPSNSKQV--SMLYYLECP 249
            |.||        |.|:|||.|.::||.:::....:.|.      .:||.....|  ||    |.|
Mouse   160 PGDTCTRYGMASCRLSANRSLLASADAVVFHHRELQTRQSLLPLDQRPHGQPWVWASM----ESP 220

  Fly   250 YHTQNV-KVPDAINWTATYRRDSTIVAPYEKWQYYDTKVQQQEQDINYSVNKTKKVAWFVSNCGA 313
            .:|..: :.....||..:|||||.|..||       .:::......:....|::..||.:||...
Mouse   221 SNTHGLHRFRGIFNWVLSYRRDSDIFVPY-------G
RLEPLSGPTSPLPAKSRMAAWVISNFQE 278

  Fly   314 RNGRLQYAHELQKYIEVDIYG------ACGNFKCSRSTADKCFEILDNDYKFYLAFENSNCKDYI 372
            |..|.:...:|..:::||::|      .|.|  |...|..:        |:||||||||..:|||
Mouse   279 RQQRAKLYRQLAPHLQVDVFGRASGRPLCAN--CLLPTLAR--------YRFYLAFENSQHRDYI 333

  Fly   373 TEKFFVNALNRRVLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFK 437
            ||||:.|||....:|:.:|.....||...|..:::|||:|||.:|||.:|  :..::..|..:|.
Mouse   334 TEKFWRNALAAGAVPVALGPPRATYEAFVPPDAFVHVDDFSSARELAVFL--VSMNESRYRGFFA 396

  Fly   438 WKG------TGEFINTYYWCRVCATLHNEEQLRKPRWYTDLNDWWR 477
            |:.      .|::...:  |.:||   ....|.:.:.|.||..|::
Mouse   397 WRDRLRVRLLGDWRERF--CTICA---RYPYLPRSQVYEDLESWFQ 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 28/92 (30%)
Glyco_transf_10 300..473 CDD:279224 59/184 (32%)
Fut7XP_011237324.1 Glyco_tran_10_N 140..250 CDD:374959 30/100 (30%)
Glyco_transf_10 265..433 CDD:366335 59/184 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6052
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - mtm8745
orthoMCL 1 0.900 - - OOG6_100170
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3232
SonicParanoid 1 1.000 - - X114
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.800

Return to query results.
Submit another query.