DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTA and LOC100498016

DIOPT Version :9

Sequence 1:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_031747984.1 Gene:LOC100498016 / 100498016 -ID:- Length:373 Species:Xenopus tropicalis


Alignment Length:295 Identity:103/295 - (34%)
Similarity:148/295 - (50%) Gaps:41/295 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 PVDTCE---------LTANRDLASTADM-------ILYKDHYIPTGIRRPSNSKQVSMLYYLECP 249
            |:|:||         |||:|.|.:.||.       |:|....:|   :.|....|..:.:.||.|
 Frog    88 PLDSCETVYGISGCKLTADRQLYNVADAVIIHHADIMYNKETLP---QTPRPHYQRWVWFNLEPP 149

  Fly   250 YHTQNVKVPDAI-NWTATYRRDSTIVAPYEKWQYYDTKVQQQEQDINYSV-NKTKKVAWFVSNCG 312
            ...||:...|.: |.|.|:|:||.|...|       .:::..::..|.:: .|:|.|||.||...
 Frog   150 LIIQNLHFLDNLFNLTMTFRQDSDIYVTY-------G
RIEAVKEPQNVTIPPKSKLVAWVVSKWY 207

  Fly   313 ARNGRLQYAHELQKYIEVDIYGACGNFKCSRSTADKCFEILDNDYKFYLAFENSNCKDYITEKFF 377
            ....|::|..||:|||.||:|   ||.....|..|....|:  .||||||||||..|||||||.:
 Frog   208 PGAPRIKYYEELKKYISVDVY---GNEHMKLSKQDFYNTII--QYKFYLAFENSIYKDYITEKLW 267

  Fly   378 VNALNRRVLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFKWKGTG 442
            .|:|....:|:|:|...::||...|..::||||:|.|.||||.:|..||.|||.|..||.|:...
 Frog   268 SNSLGTWSVPVVLGTSRKNYERFIPGDAFIHVDDFPSAKELAHFLFELDKDDERYRKYFNWRHHH 332

  Fly   443 EFINTYYW----CRVCATLHNEEQLR----KPRWY 469
            ....:..|    |:.|..|..:.:.:    ..:|:
 Frog   333 HVKVSDGWPGWYCKACRVLKEQTEYQVIPSVEKWF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 29/92 (32%)
Glyco_transf_10 300..473 CDD:279224 72/178 (40%)
LOC100498016XP_031747984.1 Glyco_tran_10_N 74..179 CDD:407214 30/100 (30%)
Glyco_transf_10 195..364 CDD:395683 71/173 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4795
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34780
Inparanoid 1 1.050 160 1.000 Inparanoid score I4141
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - otm48010
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X114
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.070

Return to query results.
Submit another query.