DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTA and fut6

DIOPT Version :9

Sequence 1:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_017948723.1 Gene:fut6 / 100495376 XenbaseID:XB-GENE-6037628 Length:349 Species:Xenopus tropicalis


Alignment Length:334 Identity:114/334 - (34%)
Similarity:166/334 - (49%) Gaps:47/334 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 VPHNYEEIKSSGKLKTILLYNGLGPWNVKKGRDVFLKAKCPVD----TCELTANRDLASTADMIL 221
            ||...||     .:|.|||      |....| ..|...:||..    .|..|.||.|.|.|..::
 Frog    46 VPSKPEE-----PVKIILL------WTWPFG-FAFPLNQCPSQFDGTGCFFTVNRSLYSEAAAVV 98

  Fly   222 YKDHYIPTG------IRRPSNSKQVSMLYYLECPYHTQNVK-VPDAINWTATYRRDSTIVAPYEK 279
            .....:.:.      ::||.|  |..:.:.||.|.|..|.. :...||.|.|||.||.|..|| .
 Frog    99 LHSRDVCSSKNQLPQMQRPPN--QYWIWFTLESPSHNPNTGFMEKLINLTMTYRADSDIFTPY-G 160

  Fly   280 WQYYDTKVQQQEQDINYSV-NKTKKVAWFVSNCGARNGRLQYAHELQKYIEVDIYGACGNFKCSR 343
            |      :::.:...|.|: .|||.|||.|||....:.|::|..||:.::.||::   ||.:. :
 Frog   161 W------LERHDGTENVSIPEKTKLVAWVVSNWNPNSRRVKYYGELKNHLAVDVF---GNQRL-Q 215

  Fly   344 STADKCFEILDNDYKFYLAFENSNCKDYITEKFFVNALNRRVLPIVMGARPEDYEVSAPRRSYIH 408
            ...||..|.| :.||||||||||..:||||||.:.|||....:|:|:|....:||...|..::||
 Frog   216 LPRDKHIETL-SKYKFYLAFENSIHEDYITEKLWHNALASWAVPVVLGPTRANYERFLPPDAFIH 279

  Fly   409 VDEFSSPKELAEYLRILDHDDELYNSYFKWKGTGEFI-----NTYYWCRVCATLHNEEQLRKPRW 468
            ||:|.:.|.||:||..||.||..|..:|.|:.:.:.:     ||:| |:||..:   ::....|.
 Frog   280 VDDFPTAKGLADYLHALDKDDNRYKQHFNWRRSLKPVAPDSWNTHY-CKVCKAI---KEAPSYRT 340

  Fly   469 YTDLNDWWR 477
            ...:.:|::
 Frog   341 VPSITNWFK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 34/114 (30%)
Glyco_transf_10 300..473 CDD:279224 70/177 (40%)
fut6XP_017948723.1 Glyco_tran_10_N 52..160 CDD:407214 37/122 (30%)
Glyco_transf_10 176..345 CDD:395683 70/177 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4795
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34780
Inparanoid 1 1.050 160 1.000 Inparanoid score I4141
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - otm48010
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3232
SonicParanoid 1 1.000 - - X114
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.100

Return to query results.
Submit another query.