DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FucTA and fut7

DIOPT Version :9

Sequence 1:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001165371.1 Gene:fut7 / 100335040 XenbaseID:XB-GENE-996189 Length:345 Species:Xenopus tropicalis


Alignment Length:320 Identity:107/320 - (33%)
Similarity:149/320 - (46%) Gaps:45/320 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 TILLYNGLGPWNVKKGRDVFLKAKCPVDT-----CELTANRDLASTADMILY-------KDHYIP 228
            |||:::    |...:..|  |.....:|.     |.||.||.....|.::::       |....|
 Frog    45 TILIWH----WPFHRPMD--LSGNVCLDRFGIGGCRLTGNRSDFPRAQVVVFHHKELREKGFEFP 103

  Fly   229 TGIRRPSNSKQVSMLYYLECP-YHTQNVKVPDAINWTATYRRDSTIVAPYEKWQYYDTKVQQQEQ 292
            ..: ||...|.|  ...||.| |..::|::.|..|||.:||.||.|..||........||.... 
 Frog   104 DTV-RPLGQKWV--WASLEPPTYMHKDVELNDLFNWTLSYRTDSDIFVPYGMLVPQPAKVPNLP- 164

  Fly   293 DINYSVNKTKKVAWFVSNCGARNGRLQYAHELQKYIEVDIYGACGNFKCSRSTADKCFEILDNDY 357
                  |||.:|:|.||:......|..:...|..|::|||||....    |.....|.....:.|
 Frog   165 ------NKTGQVSWVVSHYRKSQERAAFYSNLSHYLKVDIYGKANR----RPLCPACLLPTVSRY 219

  Fly   358 KFYLAFENSNCKDYITEKFFVNALNRRVLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYL 422
            :||||.|||..:||||||.:.|:.....:|:|:|...|:||...|..|:|||.:|:||:.||.||
 Frog   220 RFYLALENSRHRDYITEKLWFNSFLSGSVPVVLGPPRENYERFVPADSFIHVSDFASPEHLARYL 284

  Fly   423 RILDHDDELYNSYFKWKGTGEFINTYY-W----CRVCATLHNEEQLRKPRWYTDLNDW-W 476
            |.|  .||.|..||:|: ..:.:..|. |    |.:||...|   |.:.:.|.||:.| |
 Frog   285 RTL--SDERYRRYFRWR-ERQGVKIYSDWRERFCLICAAQPN---LPRNKVYRDLHGWIW 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 33/113 (29%)
Glyco_transf_10 300..473 CDD:279224 66/177 (37%)
fut7NP_001165371.1 Glyco_tran_10_N 41..151 CDD:293644 34/114 (30%)
Glyco_transf_10 166..334 CDD:279224 66/177 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.