DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex3 and SPAC29A4.14c

DIOPT Version :9

Sequence 1:NP_001261871.1 Gene:Pex3 / 39652 FlyBaseID:FBgn0036484 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_594868.2 Gene:SPAC29A4.14c / 2541734 PomBaseID:SPAC29A4.14c Length:346 Species:Schizosaccharomyces pombe


Alignment Length:323 Identity:61/323 - (18%)
Similarity:132/323 - (40%) Gaps:49/323 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLSRLQDFLSRHRRK---FIV-TGVLVGGTIFAARYAQRRFVEFQEKQAREFFERTRRTTHFEST 61
            ||...:..|:...||   ||: :.:.|.|...|....:..|:||.|.:.    .:::....|.:.
pombe     1 MLKSFEKHLNAVSRKCCNFILGSSIPVLGFYCADTCIRNAFMEFMETRN----SKSKYVEAFNTV 61

  Fly    62 EKTCNQVILGMGEEMCQAVLRECSTDELLEQLRQ------NPKNKLELWEDMKIVAFTRLATYVY 120
            :.......:.....:...::|......::::||:      :.:.|:.||..:|.::..|:.|.:.
pombe    62 QSNGATSAISTFHILKDEIIRRIPLLPIIQELRETRMSEVSAEEKILLWNQLKFMSLVRMFTTLA 126

  Fly   121 ASSMLVIALRVQLNLLGGYIYRDIMTEQKQVTDELKQQ-------YLSLIRHFITDSGIRDLARY 178
            ..:...:..::.|.:||...:::.|.::...::.|:..       ..:.|.:.:.::.:.:|.:.
pombe   127 VLAQCNLLCKLALTVLGREAFKEQMVKEFDPSNTLRPSGSDEDPAVFTGIAYILLNNQLDELIQQ 191

  Fly   179 IRTQVIAVTKTIPLSEQLSLSDL--EQLFWSLQMAI------NADTRRDPNSRMSKYLLPSQNPS 235
            ::   :|||.|.   |::|.:|:  .:|..:|...:      |.....|.|..:....:|.|...
pombe   192 VQ---LAVTLTF---EEVSPTDIVDRKLIEALTTRVVEVFVNNYQFSIDGNKEVLLAEIPKQYIV 250

  Fly   236 HSPLLQKMVNETLDLLESEDAVGVCSHNVSRGFVLACDAIAESMGETLQHLPQ-----AKVQT 293
            ...||.::: |..|.....||..|..:.:.        |:.|.|...|..:||     ||:.|
pombe   251 TGNLLYRVL-ELEDFATQMDASIVMKNELI--------ALNEHMLTYLPSIPQEGIRLAKILT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex3NP_001261871.1 Peroxin-3 11..268 CDD:282706 49/281 (17%)
SPAC29A4.14cNP_594868.2 Peroxin-3 <106..>221 CDD:282706 22/120 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004280
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103586
Panther 1 1.100 - - LDO PTHR28080
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.