DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and TXNDC2

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001091999.1 Gene:TXNDC2 / 84203 HGNCID:16470 Length:553 Species:Homo sapiens


Alignment Length:435 Identity:107/435 - (24%)
Similarity:161/435 - (37%) Gaps:87/435 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTG--PPAKD 139
            |..|:..|.|.....|.|.|......|.    .|..|::...|......:.....|.|  |.|.:
Human   124 EETIQSKKEDLPKSSEKAIQPKESNIPK----SSAKPIQPKLGNIPKASVKPSQPKEGDIPKAPE 184

  Fly   140 LTSVADAEQFLKDNEIAIIGFFKDLESEEAKTF-TKVAN-ALDSFVFGVSSNADV---------- 192
            .|..:..|...|.:|.||.....|:....||.. .|:.| |..|........:|:          
Human   185 ETIQSKKEDLPKSSEEAIQPKEGDIPKSSAKPIQPKLGNIAKTSVKPSQPKESDIPKSPEETIQP 249

  Fly   193 ----IAKYEAKDNGVVL-------FKPFDDKKSVFEGELN----------EENLKKFAQVQSLPL 236
                |.|..||.....|       .||...|    ||:::          |.:|.|..:....|.
Human   250 KEGDIPKSSAKPIQPKLGNIPKASVKPSQPK----EGDISKSPEEAIQPKEGDLPKSLEEAIQPK 310

  Fly   237 IVDF--NHESASKIFGGSIKSHLLFFVSREGGHI----EKYVDPLK-EIAKKYRDDIL------- 287
            ..|.  :.|.|.:...|.|...|...:..:.|.|    |:.:.|.| :|.|...:.|.       
Human   311 EGDIPKSPEEAIQPKEGDIPKSLEEAIQPKEGDIPKSPEETIQPKKGDIPKSPEEAIQPKEGDIP 375

  Fly   288 ---FVTISSDEEDHTRIFEFFGMNKEEVP--TIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFL 347
               ...|...|.|..:..|      |.:|  .|.:.|..|:  ..:|:.||......||...|  
Human   376 KSPKQAIQPKEGDIPKSLE------EAIPPKEIDIPKSPEE--TIQPKEDDSPKSLEEATPSK-- 430

  Fly   348 DGK-LKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKS--KSVLVEFYAPWCGHCKQLAPIYDQ 409
            :|. ||....:.|.||. ||  |||::|......:|.::  :.|.|:|.|.|||.|:.:.|.:..
Human   431 EGDILKPEEETMEFPEG-DK--VKVILSKEDFEASLKEAGERLVAVDFSATWCGPCRTIRPFFHA 492

  Fly   410 LAEKYKDNEDIVIAKMDSTANELESI----KISSFPTIKYFRKED 450
            |:.|:   ||:|..::|  |:..|.:    .|...||.::::||:
Human   493 LSVKH---EDVVFLEVD--ADNCEEVVRECAIMCVPTFQFYKKEE 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 107/435 (25%)
pdi_dom 33..133 CDD:273454 11/55 (20%)
PDI_b_family 137..231 CDD:239279 28/126 (22%)
PDI_b'_family 244..347 CDD:239280 27/119 (23%)
PDI_a_PDI_a'_C 368..469 CDD:239293 27/89 (30%)
TXNDC2NP_001091999.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..442 75/335 (22%)
22 X 15 AA approximate tandem repeat of Q-P-K-X-G-D-I-P-K-S-[PS]-E-[KE]-X-I 113..442 75/335 (22%)
TRX_family 457..550 CDD:239245 23/81 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.