DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and PDIL5-2

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_564462.1 Gene:PDIL5-2 / 840461 AraportID:AT1G35620 Length:440 Species:Arabidopsis thaliana


Alignment Length:388 Identity:103/388 - (26%)
Similarity:170/388 - (43%) Gaps:64/388 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLICAL-FLAASY-VAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALA 63
            :|.|:|.: ||..|. ::||::.:..::..||..|..||...|:..:.:.|:||||||||||.|.
plant     4 LKLLLCWISFLTLSISISASSDDQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLN 68

  Fly    64 PEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAW 128
            ||...||..||:.:.||.:||::|.....||.:..:..:|||..:..|.|:||.|.|:|..::.:
plant    69 PELDAAAPILAKLKQPIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRY 133

  Fly   129 VTKKTGPPAKDLTSVADAEQFLKD-------------NEIAIIGFFKDLESEEAKTFTKVANALD 180
            :.|...|....|.|.:..::|::|             ||..|.|.        .:.:.|.|    
plant   134 LKKFVAPDVAVLESDSTVKEFVEDAGTFFPVFIGFGLNESIISGL--------GRKYKKKA---- 186

  Fly   181 SFVFGVSS--NADVIAKYE-AKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNH 242
              .|.||.  :.|.:..|: .|...:|...|..::.|||.|...:..|::|.:...||||:..||
plant   187 --WFAVSKEVSEDTMVSYDFDKAPALVANHPTYNEHSVFYGPFEDGFLEEFVKQSFLPLILPINH 249

  Fly   243 ESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDIL-FVTISSDEEDHTRIFEFFG 306
            ::...:.....|..|..........:||....|:..|...||.:. :|.:...||    ..:.|.
plant   250 DTLKLLKDDERKIVLTIVEDETHESLEKLYKALRAAAHANRDLVFGYVGVKQFEE----FVDSFH 310

  Fly   307 MNK----------------EEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQ 353
            ::|                ::|..|..|..|||           ....:..||:.:.:|:.::
plant   311 VDKKTNLPKIVVWDGDEEYDQVTGIETITQEED-----------HLTQVSRFLEGYREGRTEK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 95/360 (26%)
pdi_dom 33..133 CDD:273454 40/99 (40%)
PDI_b_family 137..231 CDD:239279 24/109 (22%)
PDI_b'_family 244..347 CDD:239280 21/119 (18%)
PDI_a_PDI_a'_C 368..469 CDD:239293
PDIL5-2NP_564462.1 ER_PDI_fam 34..>327 CDD:273457 86/310 (28%)
PDI_a_family 35..134 CDD:239259 40/98 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.