DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and PDIL2-2

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_171990.3 Gene:PDIL2-2 / 839355 AraportID:AT1G04980 Length:447 Species:Arabidopsis thaliana


Alignment Length:495 Identity:102/495 - (20%)
Similarity:145/495 - (29%) Gaps:233/495 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLICALFLA------ASYVAASAEAEVKVEEGVLVATVDNFK-QLIADNEFVLVEFYAPWCGHCK 60
            |.||.|..|      |.|.::|.         ||..|..||| :::..|..|||||:|||||||:
plant    11 FPICCLLFALFDRGNALYGSSSP---------VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQ 66

  Fly    61 ALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGS-PVEYSGGRQAAD 124
            :|.|.:.|.|..|   :....:|.:||.....:::.|.|||:||:|.|..|. |::|.|.|.|..
plant    67 SLTPTWEKVASTL---KGIATVAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKS 128

  Fly   125 IIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSN 189
            |..:..|:             .:..|||.                         ||         
plant   129 ISQFAIKQ-------------IKALLKDR-------------------------LD--------- 146

  Fly   190 ADVIAKYEAKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIK 254
                .|.....||                                                    
plant   147 ----GKTSGTKNG---------------------------------------------------- 155

  Fly   255 SHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIK 319
                      ||..||                                                 
plant   156 ----------GGSSEK------------------------------------------------- 161

  Fly   320 LEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDK 384
                    |......|.|                                  |.||||:.:..:.
plant   162 --------KKSEPSASVE----------------------------------LNSSNFDELVTES 184

  Fly   385 SKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKE 449
            .:..:|||:||||||||:|||.:.:.|...|....:.....|:..:.....|:..||||..|..:
plant   185 KELWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVNCDAEQSIKSRFKVQGFPTILVFGSD 249

  Fly   450 DNKVIDFNLDRTLDDFVKF----LDANGEVADSEPVEETE 485
            .:..:.:...|:......|    |::|     :.|.|.||
plant   250 KSSPVPYEGARSASAIESFALEQLESN-----AGPAEVTE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 90/452 (20%)
pdi_dom 33..133 CDD:273454 41/101 (41%)
PDI_b_family 137..231 CDD:239279 8/93 (9%)
PDI_b'_family 244..347 CDD:239280 7/102 (7%)
PDI_a_PDI_a'_C 368..469 CDD:239293 30/104 (29%)
PDIL2-2NP_171990.3 PDI_a_P5 33..134 CDD:239299 42/112 (38%)
PDI_a_P5 168..270 CDD:239299 32/135 (24%)
Thioredoxin_6 201..391 CDD:290560 21/89 (24%)
P5_C 279..408 CDD:239281 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.