DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and ACHT4

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_172333.1 Gene:ACHT4 / 837379 AraportID:AT1G08570 Length:275 Species:Arabidopsis thaliana


Alignment Length:236 Identity:51/236 - (21%)
Similarity:89/236 - (37%) Gaps:67/236 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 DDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKP-------------ESDD-- 333
            ||..|..:|         |..||:.|    :...:||:..    ||             :|.|  
plant    22 DDFSFSPVS---------FGGFGLKK----SFSCLKLKSQ----KPLRSVFYGKQIVFGDSQDES 69

  Fly   334 ------------LSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSK 386
                        |...|.:.:.:|.|...:::...:|||                .:|:.....|
plant    70 FRRSSAITAQTTLRIGTAQKWWEKGLKDNMREISSAQEL----------------VDSLTNAGDK 118

  Fly   387 SVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANE--LESIKISSFPTIKYFRKE 449
            .|:|:|::|.||.||.|.|...|.||.   |.|:...:::...::  ..|:.:...|..:::|..
plant   119 LVVVDFFSPGCGGCKALHPKICQFAEM---NPDVQFLQVNYEEHKSMCYSLGVHVLPFFRFYRGS 180

  Fly   450 DNKVIDFN-LDRTLDDFVKFLDANG-EVADSEPVEETEEEE 488
            ..:|..|: .:.|:..|...|..:| :.....|.:..||:|
plant   181 QGRVCSFSCTNATIKKFRDALAKHGPDRCSLGPTKGLEEKE 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 47/220 (21%)
pdi_dom 33..133 CDD:273454
PDI_b_family 137..231 CDD:239279
PDI_b'_family 244..347 CDD:239280 17/89 (19%)
PDI_a_PDI_a'_C 368..469 CDD:239293 24/103 (23%)
ACHT4NP_172333.1 TRX_family 115..202 CDD:239245 23/89 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.