DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and AT3G62510

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001327881.1 Gene:AT3G62510 / 825425 AraportID:AT3G62510 Length:113 Species:Arabidopsis thaliana


Alignment Length:48 Identity:15/48 - (31%)
Similarity:30/48 - (62%) Gaps:1/48 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 DLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESV 380
            ::..:.||:::|.|.|||...|..||.:|.: :..|||::|:.:.:.:
plant    27 EVEVDQIESWVKDFQDGKAAVHKNSQPIPAE-NNEPVKLVVAESLDDI 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 15/48 (31%)
pdi_dom 33..133 CDD:273454
PDI_b_family 137..231 CDD:239279
PDI_b'_family 244..347 CDD:239280 3/13 (23%)
PDI_a_PDI_a'_C 368..469 CDD:239293 4/13 (31%)
AT3G62510NP_001327881.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462118at2759
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.