powered by:
Protein Alignment Pdi and AT3G62510
DIOPT Version :9
Sequence 1: | NP_001287070.1 |
Gene: | Pdi / 39651 |
FlyBaseID: | FBgn0286818 |
Length: | 496 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001327881.1 |
Gene: | AT3G62510 / 825425 |
AraportID: | AT3G62510 |
Length: | 113 |
Species: | Arabidopsis thaliana |
Alignment Length: | 48 |
Identity: | 15/48 - (31%) |
Similarity: | 30/48 - (62%) |
Gaps: | 1/48 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 333 DLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESV 380
::..:.||:::|.|.|||...|..||.:|.: :..|||::|:.:.:.:
plant 27 EVEVDQIESWVKDFQDGKAAVHKNSQPIPAE-NNEPVKLVVAESLDDI 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0190 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D462118at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000292 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.