DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and UNE5

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_182269.1 Gene:UNE5 / 819360 AraportID:AT2G47470 Length:361 Species:Arabidopsis thaliana


Alignment Length:512 Identity:113/512 - (22%)
Similarity:172/512 - (33%) Gaps:259/512 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLICALFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYA 67
            |.:.||.|.::           |.:.|:|.|.|:|::.:..::..|||||||||||||.|||||.
plant    10 FALLALLLVSA-----------VADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63

  Fly    68 KAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGS--PVEYSGGRQAADIIAWVT 130
            |..... :|...:.:||||...:..:..:|.|.||||:::|..||  |.:|.|.|          
plant    64 KLGASF-KKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPR---------- 117

  Fly   131 KKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAK 195
                                                                      ||:.:|:
plant   118 ----------------------------------------------------------NAEALAE 124

  Fly   196 YEAKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFF 260
            |                                                                
plant   125 Y---------------------------------------------------------------- 125

  Fly   261 VSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMA 325
            |::|||                                              ..::|..:.::  
plant   126 VNKEGG----------------------------------------------TNVKLAAVPQN-- 142

  Fly   326 KYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLV 390
                                                       |.||...||:.:.||::|.|||
plant   143 -------------------------------------------VVVLTPDNFDEIVLDQNKDVLV 164

  Fly   391 EFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANEL--ESIKISSFPTIKYFRKEDNKV 453
            |||||||||||.|||.|:::|..:|..|.:|||.:|:.|::.  |...:|.|||:|:|.|::...
plant   165 EFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAG 229

  Fly   454 IDFNLDRTLDDFVKFL--------DANGEVAD------------SEPVEETEEEEEA 490
            .|::..|.|||||.|:        |:.|::..            .|.|..:|:|::|
plant   230 HDYDGGRDLDDFVSFINEKSGTSRDSKGQLTSKAGIVESLDALVKELVAASEDEKKA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 102/458 (22%)
pdi_dom 33..133 CDD:273454 40/101 (40%)
PDI_b_family 137..231 CDD:239279 4/93 (4%)
PDI_b'_family 244..347 CDD:239280 5/102 (5%)
PDI_a_PDI_a'_C 368..469 CDD:239293 49/102 (48%)
UNE5NP_182269.1 PDI_a_ERp38 28..126 CDD:239296 44/230 (19%)
PDI_a_ERp38 142..245 CDD:239296 49/147 (33%)
ERp29c 266..357 CDD:238146 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 109 1.000 Domainoid score I2141
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.