DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and PDIL2-3

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_180851.1 Gene:PDIL2-3 / 817854 AraportID:AT2G32920 Length:440 Species:Arabidopsis thaliana


Alignment Length:461 Identity:94/461 - (20%)
Similarity:140/461 - (30%) Gaps:217/461 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VLVATVDNFK-QLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGE 92
            |:..|..||| :::..|..|||||:||||||||||.|.:.|.|..|   :....:|.:||.....
plant    32 VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANIL---KGVATVAAIDADAHQS 93

  Fly    93 LAEQYAVRGYPTLKFFRSG-SPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIA 156
            .|:.|.::|:||:|.|..| :|::|.|.|.|..|                               
plant    94 AAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSI------------------------------- 127

  Fly   157 IIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKSVFEGELN 221
                               ||                                            
plant   128 -------------------AN-------------------------------------------- 129

  Fly   222 EENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDI 286
                  ||..|...|:.| ..|..||..||..|              ||..:|            
plant   130 ------FAYKQIKGLLSD-RLEGKSKPTGGGSK--------------EKKSEP------------ 161

  Fly   287 LFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKL 351
                                                             :.::|           
plant   162 -------------------------------------------------SASVE----------- 166

  Fly   352 KQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKD 416
                                |.:|||:.:.::.::..:|||:||||||||:|||.:.:.|:..:.
plant   167 --------------------LNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNLQG 211

  Fly   417 NEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGEVADSE-- 479
            ...:.....|...:.:...|:..||||..|..:.:....:...|:......|.   .|:.:|.  
plant   212 KVKLGHVNCDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFA---SELVESSAG 273

  Fly   480 PVEETE 485
            |||.||
plant   274 PVEVTE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 87/446 (20%)
pdi_dom 33..133 CDD:273454 41/101 (41%)
PDI_b_family 137..231 CDD:239279 4/93 (4%)
PDI_b'_family 244..347 CDD:239280 9/102 (9%)
PDI_a_PDI_a'_C 368..469 CDD:239293 27/100 (27%)
PDIL2-3NP_180851.1 PDI_a_P5 31..132 CDD:239299 45/202 (22%)
PDI_a_P5 163..265 CDD:239299 29/135 (21%)
P5_C 274..403 CDD:239281 5/6 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.