DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and TXNDC5

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_110437.2 Gene:TXNDC5 / 81567 HGNCID:21073 Length:432 Species:Homo sapiens


Alignment Length:470 Identity:110/470 - (23%)
Similarity:185/470 - (39%) Gaps:145/470 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TVDNFKQLI-ADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEK-----ESPIKLAKVDATVEG 91
            |.|.|...| :...||:  |:|||||||:.|.|.:    ..|.:|     ::.:.:||||.|...
Human    67 TADMFTHGIQSAAHFVM--FFAPWCGHCQRLQPTW----NDLGDKYNSMEDAKVYVAKVDCTAHS 125

  Fly    92 ELAEQYAVRGYPTLKFFRSG-SPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEI 155
            ::.....||||||||.|:.| ..|:|.|.|.                                  
Human   126 DVCSAQGVRGYPTLKLFKPGQEAVKYQGPRD---------------------------------- 156

  Fly   156 AIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKSVFEGEL 220
                 |:.||:...:|                                                |
Human   157 -----FQTLENWMLQT------------------------------------------------L 168

  Fly   221 NEENLKKFAQVQ--SLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDP----LKEIA 279
            |||.:....:|:  |.|.:....:|.::..|    :.|:     .:|.|..|:..|    .|.:|
Human   169 NEEPVTPEPEVEPPSAPELKQGLYELSASNF----ELHV-----AQGDHFIKFFAPWCGHCKALA 224

  Fly   280 KKYRDDILFV----TISSDEEDHTRIFEFFGMNK-EEVPTIRLIKLEEDMAKYKPESDDLSAETI 339
            ..:....|.:    |:...:.|.|:.:|....|: ...||:...:..:.:.:||.:.|      :
Human   225 PTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRD------L 283

  Fly   340 EAFLKKFLDGKLK-------QHLLSQELP-----EDWDKNPVKVLVSSNFESVALDKSKSVLVEF 392
            |: |:::::.:|:       :.:...|.|     .:.||..|..|..:||:....:  ....::|
Human   284 ES-LREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAE--GITFIKF 345

  Fly   393 YAPWCGHCKQLAPIYDQLAEK-YKDNEDIVIAKMDSTA--NELESIKISSFPTIKYFRKEDNKVI 454
            |||||||||.|||.:::|::| :.....:.||::|.||  |......:..:||:..|| ...||.
Human   346 YAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFR-GGKKVS 409

  Fly   455 DFNLDRTLDDFVKFL 469
            :.:..|.||...:|:
Human   410 EHSGGRDLDSLHRFV 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 110/470 (23%)
pdi_dom 33..133 CDD:273454 37/106 (35%)
PDI_b_family 137..231 CDD:239279 8/93 (9%)
PDI_b'_family 244..347 CDD:239280 21/111 (19%)
PDI_a_PDI_a'_C 368..469 CDD:239293 34/103 (33%)
TXNDC5NP_110437.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..63
PDI_a_ERp46 61..164 CDD:239303 40/141 (28%)
ER_PDI_fam 66..432 CDD:273457 110/470 (23%)
PDI_a_ERp46 190..290 CDD:239303 22/115 (19%)
PDI_a_ERp46 323..424 CDD:239303 34/103 (33%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 429..432
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.