DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and Erp27

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_081259.1 Gene:Erp27 / 69187 MGIID:1916437 Length:272 Species:Mus musculus


Alignment Length:312 Identity:69/312 - (22%)
Similarity:131/312 - (41%) Gaps:69/312 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRS 110
            ||||      ||....:..:..:|...|:..:.||.|..|.||||                    
Mouse    13 FVLV------CGLVPEVTADVEEATDGLSTTQEPIWLTDVPATVE-------------------- 51

  Fly   111 GSPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKV 175
                                         |.:.|         |:|:||||:|||......|..:
Mouse    52 -----------------------------LIAAA---------EVAVIGFFQDLEIPIVSVFRSM 78

  Fly   176 ANALDSFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKSVFEGE----LNEENLKKFAQVQSLPL 236
            |.......||:|::::|:..|....|.:.||:..||::.....|    |:...|.:|..|.:|..
Mouse    79 ARQFQDVSFGISNHSEVLTHYNVTSNSICLFRLVDDQQLHLNAEDIENLDAAKLSRFIHVNNLHW 143

  Fly   237 IVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRI 301
            :.:::...|:.:|...:::|||..:.:.....|:.:...:|.||.::..||||.:.|.:.::.::
Mouse   144 VTEYSPMIAAGLFNTMVQTHLLLMMKKTSPEYEESMRRYREAAKLFQGQILFVLVDSGKRENGKV 208

  Fly   302 FEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQ 353
            ..:|.:.:.::|.:.:.:..:|.....|.: :::.|.:..|.:.||.|.|::
Mouse   209 MSYFKLKESQLPALAIYESVDDKWDTLPIA-EVTVEKVRGFCEGFLKGLLQR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 69/312 (22%)
pdi_dom 33..133 CDD:273454 16/86 (19%)
PDI_b_family 137..231 CDD:239279 27/97 (28%)
PDI_b'_family 244..347 CDD:239280 20/102 (20%)
PDI_a_PDI_a'_C 368..469 CDD:239293
Erp27NP_081259.1 Thioredoxin_6 64..250 CDD:372755 42/186 (23%)
PDIA3-binding site. /evidence=ECO:0000250|UniProtKB:Q96DN0 230..233 1/2 (50%)
Prevents secretion from ER. /evidence=ECO:0000250|UniProtKB:Q96DN0 269..272
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846780
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18929
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.910

Return to query results.
Submit another query.