DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and TMX4

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_066979.2 Gene:TMX4 / 56255 HGNCID:25237 Length:349 Species:Homo sapiens


Alignment Length:346 Identity:74/346 - (21%)
Similarity:126/346 - (36%) Gaps:84/346 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LICALFLAASYVAASAEAEVKVEEG-VLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPE-- 65
            |:.|...|.:..|...||.:..|:. |...|..|: .|:.:.|::| :||||||..|:....|  
Human    13 LLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNW-TLVMEGEWML-KFYAPWCPSCQQTDSEWE 75

  Fly    66 -YAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWV 129
             :||..:.|     .|.:.|||...|..|:.::.|...|.....:.|....|.|.....|:..::
Human    76 AFAKNGEIL-----QISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIFEDLQNYI 135

  Fly   130 TKKTGPPAKDLT---SVADAEQFLKDNEIAIIGFFKDLESEEAKTF------TKVANALDSFVFG 185
            .:|.....:.||   |.|...........:|.|....|.:....|.      :.|...:.:.|||
Human   136 LEKKWQSVEPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTVTLGIPAWCSYVFFVIATLVFG 200

  Fly   186 VSSNADVIAKYEAKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFG 250
            :.....::...|.      .:.|.....|    |.:|:|.:                        
Human   201 LFMGLVLVVISEC------FYVPLPRHLS----ERSEQNRR------------------------ 231

  Fly   251 GSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTI 315
                       |.|....|:..|     |::.:||      |::||:...:.:    ::||...:
Human   232 -----------SEEAHRAEQLQD-----AEEEKDD------SNEEENKDSLVD----DEEEKEDL 270

  Fly   316 RLIKLEEDMAKYKPESDDLSA 336
            .    :||.|:.:.|.|:|:|
Human   271 G----DEDEAEEEEEEDNLAA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 67/323 (21%)
pdi_dom 33..133 CDD:273454 28/102 (27%)
PDI_b_family 137..231 CDD:239279 18/102 (18%)
PDI_b'_family 244..347 CDD:239280 19/93 (20%)
PDI_a_PDI_a'_C 368..469 CDD:239293
TMX4NP_066979.2 PDI_a_TMX 37..137 CDD:239292 29/106 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..349 21/117 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156382
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.