DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and txndc16

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_685017.4 Gene:txndc16 / 556973 ZFINID:ZDB-GENE-100712-1 Length:804 Species:Danio rerio


Alignment Length:440 Identity:93/440 - (21%)
Similarity:149/440 - (33%) Gaps:148/440 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 TVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWV--------TKKTGPPAKDLTSVA 144
            |.|..|.:.|..||...|:.|...:..:.:.      |::.|        ......||:    :.
Zfish    88 TGEKLLTKAYLFRGSEVLRSFDIDTVFDVNA------IVSHVLFSVLFNEVLYVHTPAE----LL 142

  Fly   145 DAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYE---------AKD 200
            ..|...|.|...::|....|...|.:...:.|     ||:|        .||:         .|.
Zfish   143 GVESAAKQNSDIVVGHIPVLGLPEHRALMETA-----FVYG--------TKYQFVQTTGSLVLKR 194

  Fly   201 NGVVLFKPFDDK--------KSV-----------FEGELNEENLKKFAQVQSLPLI--------- 237
            .|||  .|...:        |||           ....:|..|:..|.|:...||:         
Zfish   195 MGVV--NPSSSQARLWFLHCKSVSLQSDPCPSTAMSKPINTINIHTFLQLMEAPLVTEAVTDPSE 257

  Fly   238 VDFNHESAS----KIFGGSIKSHL-----------------LFFVSREGGHIEKYVDPLKEIAKK 281
            ||..|...|    .:|......||                 :..:.|:.   .|...|||..| .
Zfish   258 VDVVHIHLSVPVLYLFSQPQTQHLDRDTAQTVALQLRGEVGVVLIHRDN---PKVKTPLKYNA-A 318

  Fly   282 YR---DDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIK---LEEDMAKYKPESDDLSAETIE 340
            ||   :|:.:.|:|:.||                 .::|.|   |::|..:.:.|.|:..::   
Zfish   319 YRLPQEDVKYFTLSAPEE-----------------VVKLFKETLLQKDKTEDEEEDDEHWSD--- 363

  Fly   341 AFLKKFLDGKLKQHLLSQELPED--------WDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWC 397
                  ||      :|..|:.|.        .|..||..|.:..|:: |:.:::..:|.||..|.
Zfish   364 ------LD------ILDDEVSESVYRDRDLMLDLEPVTELTADTFQT-AIKQNEITVVLFYFKWD 415

  Fly   398 GHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESI----KISSFPTI 443
            ..|......|.::||..:|...:.:|.:|  ..|...|    .|:||||:
Zfish   416 AVCMAFIQSYVEVAEAVEDVNGVELAAVD--CGEWTDICRDQNITSFPTV 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 93/440 (21%)
pdi_dom 33..133 CDD:273454 10/52 (19%)
PDI_b_family 137..231 CDD:239279 24/121 (20%)
PDI_b'_family 244..347 CDD:239280 23/129 (18%)
PDI_a_PDI_a'_C 368..469 CDD:239293 23/80 (29%)
txndc16XP_685017.4 PDI_a_family 389..489 CDD:239259 21/78 (27%)
Thioredoxin_6 530..722 CDD:290560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.