DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and Tmx4

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_083424.1 Gene:Tmx4 / 52837 MGIID:106558 Length:335 Species:Mus musculus


Alignment Length:145 Identity:41/145 - (28%)
Similarity:66/145 - (45%) Gaps:16/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CALFLAASYVAASA-----EAEVKVEEG-VLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAP 64
            |...|.|:::||:|     :|.:..||. |...|..|: .|:.:.|::| :||||||..|:....
Mouse     6 CVPVLLAAWLAAAAAEGLEQAALPAEESRVQPMTASNW-TLVMEGEWML-KFYAPWCPSCQQTDS 68

  Fly    65 E---YAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADII 126
            |   :||..:.|     .|.:.|||...|..|:.::.|...|.....:.|....|.|.....|:.
Mouse    69 EWETFAKNGETL-----QISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIYEDLQ 128

  Fly   127 AWVTKKTGPPAKDLT 141
            .::.:|.....:.||
Mouse   129 NYILEKKWQSVEPLT 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 33/119 (28%)
pdi_dom 33..133 CDD:273454 28/102 (27%)
PDI_b_family 137..231 CDD:239279 2/5 (40%)
PDI_b'_family 244..347 CDD:239280
PDI_a_PDI_a'_C 368..469 CDD:239293
Tmx4NP_083424.1 Thioredoxin_like 33..133 CDD:294274 29/106 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846784
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.