DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and txn2

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001008161.1 Gene:txn2 / 493523 XenbaseID:XB-GENE-943373 Length:170 Species:Xenopus tropicalis


Alignment Length:107 Identity:34/107 - (31%)
Similarity:60/107 - (56%) Gaps:5/107 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VATVDNFKQLIADNEF-VLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELA 94
            |...|:|::.:..:|. |:|:|:|.|||.||.|||...|.   :|:::..:.:||||.....:||
 Frog    67 VQDADDFQERVVGSETPVVVDFHAQWCGPCKILAPRLEKV---VAKQQGKVVMAKVDIDDHTDLA 128

  Fly    95 EQYAVRGYPTLKFFRSGSPVE-YSGGRQAADIIAWVTKKTGP 135
            .::.|...||:...::|..|: :.|.:....:.|::.|..||
 Frog   129 LEFEVSAVPTVLAIKNGDVVDKFVGLKDEDQLDAFLKKLIGP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 34/107 (32%)
pdi_dom 33..133 CDD:273454 31/101 (31%)
PDI_b_family 137..231 CDD:239279
PDI_b'_family 244..347 CDD:239280
PDI_a_PDI_a'_C 368..469 CDD:239293
txn2NP_001008161.1 Thioredoxin_like 69..168 CDD:381987 31/101 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.