DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and CG14695

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster


Alignment Length:342 Identity:69/342 - (20%)
Similarity:122/342 - (35%) Gaps:123/342 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 VIAKYEAKDNGV--VLFKP---FDDKKS-----VFEGELNEENLKKFAQVQSLPLIVDFNHESAS 246
            ::..|...:|.:  :|:.|   ..|:||     .|:|                |.:|.|:     
  Fly     3 LVKTYTIDNNSIPWILWLPPLTEVDRKSPGGRFTFDG----------------PKVVAFH----- 46

  Fly   247 KIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEF------- 304
                        |..:|.|..::|::..|.|:|::|...|||     ...|.:.|.||       
  Fly    47 ------------FVKNRHGDTLDKWISLLDELAQEYAGRILF-----GLRDISNIGEFNPNLNPD 94

  Fly   305 -FGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQEL-------- 360
             ||..::.:|. |:...:.:...|     |:.......:|::|.|     .||:.:|        
  Fly    95 DFGSYRKGLPP-RIYGKDCEGRVY-----DMHKLVNAKYLREFCD-----QLLADQLFRAVVLGA 148

  Fly   361 PEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEK---YKDNEDIVI 422
            ....|..|:      |:..:..:.|..:||..|.|.|.:.    ||..::..|   ...:||:.|
  Fly   149 TASLDSKPM------NYFELREESSSDMLVMLYDPACYYW----PIQKRMLRKLIRLLASEDLPI 203

  Fly   423 AKMDSTANELE--------------------------SIKI-----SSFPTIKYF-RKEDNKVID 455
            ..:|...|.|.                          .||:     |:...::|. |....::||
  Fly   204 VIVDKANNYLGVGFTRWLQMVNCHGSTIFTSPRRDGWDIKLSVRMESTRGYLRYIARNRQPELID 268

  Fly   456 FNLD---RTLDDFVKFL 469
            |:.|   |.|:..|:::
  Fly   269 FDADGEPRALEQAVEYI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 69/342 (20%)
pdi_dom 33..133 CDD:273454
PDI_b_family 137..231 CDD:239279 9/48 (19%)
PDI_b'_family 244..347 CDD:239280 22/110 (20%)
PDI_a_PDI_a'_C 368..469 CDD:239293 29/138 (21%)
CG14695NP_650032.1 Thioredoxin_6 <20..134 CDD:290560 33/162 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.