DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and CG10029

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_649716.1 Gene:CG10029 / 40883 FlyBaseID:FBgn0037498 Length:410 Species:Drosophila melanogaster


Alignment Length:408 Identity:94/408 - (23%)
Similarity:184/408 - (45%) Gaps:51/408 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEK--- 76
            :..|..:.|.....|:..|.:|.:.:|..||.||:.||..||...:.|.|.:.:||.::.:|   
  Fly    15 ILVSLHSLVAGNSSVVAVTHENLQGIIDSNELVLLSFYTDWCRFSQILQPIFEEAAAKVIQKFPE 79

  Fly    77 ESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSG--SPVEYSGGRQAADIIAWVTKKTGPPAKD 139
            ...:.|.||:...|..||:|:.:..|||:|..|:|  ...||.|.|....:..:|.|:...|.|:
  Fly    80 NGRVILGKVNCDTEDILADQFDILKYPTIKIVRNGLIGNQEYRGQRSVEALFQFVEKELSDPIKE 144

  Fly   140 LTSVADAEQFLKDNEIA---IIGFFKDLESEEAKTFTKVANALDS---FVFGVSSNADVIAKYEA 198
            ..::.|    ||:.::.   :||:|...:..|...:.:||:.|.:   |:.|.   .|:......
  Fly   145 FHNIDD----LKNVDVGYGIVIGYFISKDHAEYDNYRRVASLLRNDCRFLVGF---GDLTKDLRP 202

  Fly   199 KDNGVVLFK---PFDDKKSVFEGELNEENLKKFAQV------QSLPLIVDFNHESASKIFGGSIK 254
            .....::|:   ...:.|:.:...|.  |:..|.::      ..:||:.:...::|.::....:.
  Fly   203 PGKNALIFRGDPSIPNHKNQYSEYLG--NMTSFKELTFWIDKTCVPLVREVTFDNAEELSEEGLP 265

  Fly   255 SHLLFFVSREGGHIEKYVDPLK-EIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLI 318
            ..|||:...:...|:::.:.:: ::..:.|  ::|:|...:...|. :|. .|.:..::|   :|
  Fly   266 FVLLFYNKDDLSPIQEFKNAIQSQMENETR--VIFLTAEGEVFKHP-LFH-LGKSPSDLP---VI 323

  Fly   319 KLEEDMAKYK-PESDDLSAETIEAFLKKFLD----GKLK-QHLLSQELPEDWDK--NPVK---VL 372
            .::..|..|. |...|:..   ...||||:|    |.|. .:.::|:..||.:.  :|.:   |:
  Fly   324 AIDSFMHMYLFPRFQDIYD---PGALKKFIDDLFSGALHYNYHVAQQAKEDLESIIDPTEDLPVV 385

  Fly   373 VSSNFESVALDKSKSVLV 390
            ..|.|:.:...|.:..||
  Fly   386 HESKFKDLKPSKHRYTLV 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 92/396 (23%)
pdi_dom 33..133 CDD:273454 35/104 (34%)
PDI_b_family 137..231 CDD:239279 19/102 (19%)
PDI_b'_family 244..347 CDD:239280 20/104 (19%)
PDI_a_PDI_a'_C 368..469 CDD:239293 7/26 (27%)
CG10029NP_649716.1 PDI_a_ERp44 27..134 CDD:239294 34/106 (32%)
PDI_b_ERp44 142..237 CDD:239368 19/103 (18%)
Thioredoxin_6 165..352 CDD:290560 36/201 (18%)
PDI_b'_ERp44 248..357 CDD:239370 22/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463709
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.