DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and txndc5

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_005162560.1 Gene:txndc5 / 406289 ZFINID:ZDB-GENE-040426-1951 Length:403 Species:Danio rerio


Alignment Length:472 Identity:118/472 - (25%)
Similarity:187/472 - (39%) Gaps:128/472 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLICALFLAASYVAASAEAEVKVEEGVL-VATVDNFKQLIAD-NEFVLVEFYAPWCGHCKALAPE 65
            ||...::||......|.:.:.:.:|... ..||:.|...|:. ..||:  |:|||||||:.|...
Zfish     4 FLTSFIYLALLCSRLSCDNDTEEDEHAKHTYTVEMFNDAISTAPHFVM--FFAPWCGHCQRLQGT 66

  Fly    66 YAKAAQQLAEKES-PIKLAKVDATVEGELAE-QYAVRGYPTLKFFR-SGSPVEYSGGRQAADIIA 127
            :.:.|.:....|: |..:.|||.|.:.:... ::.:|||||||.|: ....|:|.|.|....:..
Zfish    67 WNELADKYNSMEAPPAYVVKVDCTKDTKFCSIEHGIRGYPTLKLFKPEQEAVKYQGPRDLQALEN 131

  Fly   128 WVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADV 192
            |:.|......::..|                      |.|..|.                     
Zfish   132 WMLKTLQEEPEEPQS----------------------EPEPPKV--------------------- 153

  Fly   193 IAKYEAKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHL 257
                           | :.|:.::  ||...|.|                   |.|..|   ||.
Zfish   154 ---------------P-EPKQGLY--ELTATNFK-------------------SHIAKG---SHF 178

  Fly   258 LFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNK-EEVPTIRLIKLE 321
            :.|.:...||.:......:::|..:...   .:|...:.|.|:.:|....|: ...||:......
Zfish   179 VKFFAPWCGHCKAMAPTWEQLASSFEHS---DSIKISKVDCTQHYEVCSDNQVRGYPTLLFFTDG 240

  Fly   322 EDMAKYKPESDDLSAETIEAFLKKFLDGKLK------------QHLLSQEL-----PEDWDKNPV 369
            |.:.:||.:.|      :::| |:|:|..:|            :|  :.|:     ||..:.| |
Zfish   241 EKIDQYKGKRD------LDSF-KEFVDNHVKAAESKDEPEKEEEH--THEIPPSAEPEKQESN-V 295

  Fly   370 KVLVSSNF-ESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEK-YKDNEDIVIAKMDSTANE- 431
            .||..||| |:||...|   .::||||||||||.|||.:|.|::| :....|:.|||:|.|... 
Zfish   296 LVLTESNFDETVAKGLS---FIKFYAPWCGHCKNLAPTWDDLSQKEFPGLTDVKIAKVDCTVERT 357

  Fly   432 -LESIKISSFPTIKYFR 447
             .....:..:||:..||
Zfish   358 LCNRFSVRGYPTLLMFR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 113/448 (25%)
pdi_dom 33..133 CDD:273454 36/103 (35%)
PDI_b_family 137..231 CDD:239279 10/93 (11%)
PDI_b'_family 244..347 CDD:239280 22/103 (21%)
PDI_a_PDI_a'_C 368..469 CDD:239293 36/84 (43%)
txndc5XP_005162560.1 ER_PDI_fam 33..403 CDD:273457 112/443 (25%)
Thioredoxin_like 34..133 CDD:294274 34/100 (34%)
PDI_a_ERp46 159..259 CDD:239303 26/133 (20%)
PDI_a_ERp46 294..395 CDD:239303 37/85 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.