DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and CG5027

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster


Alignment Length:447 Identity:98/447 - (21%)
Similarity:177/447 - (39%) Gaps:92/447 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LICALFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAK 68
            ||.||.|.......|::         ::...|.|..:..:.:: ||.|||||||:||...|.:|.
  Fly    11 LISALLLTLGSTGLSSK---------VLELSDRFIDVRHEGQW-LVMFYAPWCGYCKKTEPIFAL 65

  Fly    69 AAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKT 133
            .||.|  ..:.:::.::|.|.....|:::.||||||:.|.:......|:|.|...:::.:..:.:
  Fly    66 VAQAL--HATNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDELVDYALRMS 128

  Fly   134 GPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKY-- 196
            |||.: |.:..::...||.:......|....|.....|:...|.......|..:::.|:.|::  
  Fly   129 GPPVQ-LVTRTESVDMLKGSHTIFFIFVGQQEGVVWDTYYAAAEGYQEHGFFYATSEDIAAQHFD 192

  Fly   197 EAKDNGVVLFK-----------------PFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHES 244
            ..|...|:::|                 |.:..::||:. :|.|....|      |.:..||...
  Fly   193 FEKLPAVIVYKEEQHHFYPHGHLAHEMDPNEVNETVFQW-VNVERFTLF------PKVTRFNIHQ 250

  Fly   245 ASKIFGGSIKSHLLFFVSRE------GGHIEKYVDPLKEIAKK----YRDDILFVTISSDEEDHT 299
            ..|     ...:|:..|.:|      ..|..::.|.::.:.:|    |.|...|..|......|:
  Fly   251 LLK-----TNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRKHRARYHDKFQFGWIGEPSIAHS 310

  Fly   300 RIFEFFGMNKEEVPTIRLIKLEED-MAKYKPESD--DLSAETIEAFLKKFLDG------------ 349
            .|.       :::||..||.:... ...:.||.|  .::.:.:..||:...:.            
  Fly   311 IIL-------DQLPTPHLIAINSSTQHHFIPEDDPMQMTPQALHLFLESIRNESAIAYGGDTYFV 368

  Fly   350 KLKQHL--LSQELPEDWDKNPVKVLV----SSNFESVALDKSKSVLVEFYAPWCGHC 400
            :|.:.|  :.:.|.:.|..|||...|    ...|.|:.:          |:.:||.|
  Fly   369 RLNRALFEVRRALRDMWLGNPVLTTVIFGLPLGFLSLIM----------YSIFCGDC 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 92/424 (22%)
pdi_dom 33..133 CDD:273454 31/99 (31%)
PDI_b_family 137..231 CDD:239279 19/112 (17%)
PDI_b'_family 244..347 CDD:239280 22/115 (19%)
PDI_a_PDI_a'_C 368..469 CDD:239293 9/37 (24%)
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 31/112 (28%)
ER_PDI_fam 28..>355 CDD:273457 78/349 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463713
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.