DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and CG13671

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_648202.1 Gene:CG13671 / 38932 FlyBaseID:FBgn0035867 Length:698 Species:Drosophila melanogaster


Alignment Length:544 Identity:91/544 - (16%)
Similarity:165/544 - (30%) Gaps:194/544 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLICALFLAASYVAASAEAEVKVEEGVLV----ATVDNFKQLIADNEFVLVEFYAPWCGHCKA 61
            ||.::..|.||.|.....|......::..:|    .:|...:...:::|..|:.:|..|....:.
  Fly     1 MKIILSLLLLALSIAQLDASRSATSDQAPIVECPGRSVPQLRAEASESEISLLFYYVSWASEARQ 65

  Fly    62 LAPEYAKAAQQLAEKE--SPIKLAKVDATVEGELAEQYAVRG-------YPTLKFFRSGSP--VE 115
            ....|...|....|..  ..|....:.......|.....|.|       :||| ..|.|..  ::
  Fly    66 ARLVYNGLAHYYQEYGFFGAIDCWHLQCNCSRTLMPAPGVAGAGGYPDKWPTL-IVRYGQKQLLQ 129

  Fly   116 YSGGRQAADIIAWVTKKTGP-----PAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKV 175
            |.|.....|:..::.....|     .::||.::.      |.::..::|.   |:|.:.|.:...
  Fly   130 YQGSWSFEDLARFMNNLLQPLDRAHSSQDLAAIR------KHSDAVVLGL---LDSPDDKAYNLY 185

  Fly   176 ANA------LD-------SFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKSVFEGELNEENLKK 227
            ..|      ||       :..|| :|...::...|||                         |.:
  Fly   186 LAAGLRWLELDPERNIRFTVYFG-NSARKMLKSSEAK-------------------------LPQ 224

  Fly   228 FAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILF---- 288
            |..:.|...:..||..|.                      :.|.:|.|:.:....::..||    
  Fly   225 FVVIDSRNGVHTFNGTSG----------------------VWKTIDILRWVRSTLKNMSLFSNGY 267

  Fly   289 ---VTISSDEEDHTRIFEFFGMNKEEVPTIRL-IKLE---------EDMA--------------- 325
               :||:              |....||.:.: :::.         |:||               
  Fly   268 GTPMTIA--------------MKARHVPVLAMGVRMNQYHHASVMGEEMAYAQKKQSEGCEDYWK 318

  Fly   326 KYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLV 390
            |:..:|:|:|:...:...:.|.||:     .::.....|.||                  |:.|.
  Fly   319 KFDKQSEDISSSLNQVPKELFGDGE-----QTRTCYPAWSKN------------------KTTLK 360

  Fly   391 EFYA-------PWCGHCKQLAPIYDQLAEKYKDNE---------------DIVIAKMDSTANEL- 432
            .:|.       .|..:..|..|.|..:....:.:.               .|.||||.:...:| 
  Fly   361 NYYRINRYLNHLWRQYSHQNHPSYRNVPHLLRLHSRNLCLAHSQHGTPAIKIGIAKMVTKYGQLI 425

  Fly   433 -----------ESIKISSFPTIKY 445
                       .|:.:..|.::||
  Fly   426 WQHSTERAAHNRSLGVVIFDSVKY 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 84/518 (16%)
pdi_dom 33..133 CDD:273454 20/110 (18%)
PDI_b_family 137..231 CDD:239279 18/106 (17%)
PDI_b'_family 244..347 CDD:239280 18/134 (13%)
PDI_a_PDI_a'_C 368..469 CDD:239293 17/112 (15%)
CG13671NP_648202.1 Thioredoxin_like <46..>97 CDD:294274 8/50 (16%)
Thioredoxin_like <565..622 CDD:294274
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.