DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and Pdia5

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001014147.1 Gene:Pdia5 / 360722 RGDID:1359236 Length:517 Species:Rattus norvegicus


Alignment Length:507 Identity:113/507 - (22%)
Similarity:189/507 - (37%) Gaps:172/507 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EAEVKVEEGVLVATVDNFKQLIADNEF-VLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLA 83
            |.:...::.|.:.:..:|::|:...|. :|:.||||||..||.:.|.:.|||.|:   .....||
  Rat   143 EEDPGAKDVVHIDSEKDFRRLLKKEEKPLLMMFYAPWCSMCKRIMPHFQKAATQV---RGHTVLA 204

  Fly    84 KVDA-TVEGE-LAEQYAVRGYPTLKFFRSGSPV-EYSG-GRQAADIIAWVTKKTGPPAKDLTSV- 143
            .::. ..|.| :.|:|.||||||:.:|..|..: :|.. |..|.||:.|: |...||...:... 
  Rat   205 GMNVYPPEFENIKEEYNVRGYPTICYFEKGRFLFQYENYGSTAEDIVEWL-KNPQPPQPQVPETP 268

  Fly   144 -------------ADAEQFLKDNEIAII-------GFFKDLESEEAKTFTKVANALDSFVFGVSS 188
                         .|.:||:|::...::       |..|.::.|    |...|..|..       
  Rat   269 WADEGGSVYHLTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPE----FESAAEVLHG------- 322

  Fly   189 NADVIAKYEAKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSI 253
                    :|:.:||:         :..:..:||...::| .:.:.|.:                
  Rat   323 --------DAESSGVL---------AAVDATINEALAERF-HISAFPTL---------------- 353

  Fly   254 KSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLI 318
                                       ||                     |....::.||.:|. 
  Rat   354 ---------------------------KY---------------------FKNGEQQAVPALRT- 369

  Fly   319 KLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELP----EDWDKNPVKV--LVSSNF 377
                                    .|||:     :.:.:.|.|    ..|::....|  ||..||
  Rat   370 ------------------------KKKFI-----EWMQNPEAPPPPEPTWEEQQTSVLHLVGDNF 405

  Fly   378 ESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTAN------ELESIK 436
            .. .|.|.|..||.||||||.|||::.|.:...|:.:||:..|..|.:|...:      :.||:|
  Rat   406 RE-TLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQESVK 469

  Fly   437 ISSFPTIKYFRKEDNKVID-FNLDRTLDDFVKFLDANGEVADSEPVEETEEE 487
              ::||..|:..  .|::: :..|||...|..|:....| .|.:.:|:..|:
  Rat   470 --AYPTFHYYHY--GKLVEKYESDRTELGFTSFIRTLRE-GDLKRLEKRRED 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 108/485 (22%)
pdi_dom 33..133 CDD:273454 38/104 (37%)
PDI_b_family 137..231 CDD:239279 16/114 (14%)
PDI_b'_family 244..347 CDD:239280 8/102 (8%)
PDI_a_PDI_a'_C 368..469 CDD:239293 37/109 (34%)
Pdia5NP_001014147.1 PDI_b_PDIR_N 26..137 CDD:239365
PDI_a_PDIR 150..254 CDD:239295 37/106 (35%)
ER_PDI_fam 166..501 CDD:273457 105/466 (23%)
PDI_a_PDIR 275..377 CDD:239295 26/224 (12%)
PDI_a_PDIR 396..499 CDD:239295 37/107 (35%)
Prevents secretion from ER. /evidence=ECO:0000255 514..517 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.