DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and CG9911

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster


Alignment Length:381 Identity:98/381 - (25%)
Similarity:167/381 - (43%) Gaps:23/381 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESP----IKLAKVDAT 88
            |.:..|.||....:|.||.|.:.|||.||.....|||.:|:||.::.| |.|    :.|.|||..
  Fly    34 GAVPMTSDNIDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIKE-EFPEAGKVVLGKVDCD 97

  Fly    89 VEGELAEQYAVRGYPTLKFFRSG--SPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLK 151
            .|..:|.::.:..|||||..|:|  |..||.|.|.|...:.:|.|:...|.::..|:.|.|. |.
  Fly    98 KETAIASRFHINKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQEFKSLKDLEN-LD 161

  Fly   152 DNEIAIIGFFKDLESEEAKTFTKVA-NALDSFVFGVSSNADVIAKYEAKDNGVVLFKP----FDD 211
            ..:..|:|:|...:..|...|.||| |..:...|.|.. .|...........:::|:|    ..:
  Fly   162 SKKRLILGYFDRRDQPEYDIFRKVATNLKEDCQFHVGF-GDAAQAMHPPGTPIIVFRPDVALSHE 225

  Fly   212 KKSVFEGEL-NEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPL 275
            ....:.|.| |.:.||.:.|.:.:||:.:...|:|.::....:...:||....:...|:.|...:
  Fly   226 NDETYTGSLQNFDELKIWVQEKCVPLVREITFENAEELTEEGLPFLILFHHPTDHNSIKDYKSII 290

  Fly   276 KEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIE 340
            :......:.::.|:|  :|.:.........|.:::::|.|.:...:. |..:...||..|...::
  Fly   291 ERQLLDEKQNVNFLT--ADGKRFAHPLHHLGKSEDDLPLIAIDSFKH-MYLFPHFSDMYSPGKLK 352

  Fly   341 AFLKKFLDGKLKQHL-----LSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVE 391
            .||:....|||.:..     .|.::..|...........|.|:.:...|.:..|:|
  Fly   353 QFLQDLYSGKLHREFHYGPDPSNDIEPDPHTGKGTSPPESKFKELGPSKHRYTLLE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 98/381 (26%)
pdi_dom 33..133 CDD:273454 42/105 (40%)
PDI_b_family 137..231 CDD:239279 23/99 (23%)
PDI_b'_family 244..347 CDD:239280 17/102 (17%)
PDI_a_PDI_a'_C 368..469 CDD:239293 5/24 (21%)
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 41/106 (39%)
PDI_b_ERp44 148..241 CDD:239368 21/94 (22%)
Thioredoxin_6 171..357 CDD:290560 38/189 (20%)
PDI_b'_ERp44 252..362 CDD:239370 18/112 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463710
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.