DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and CG18130

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_572772.1 Gene:CG18130 / 32161 FlyBaseID:FBgn0030359 Length:706 Species:Drosophila melanogaster


Alignment Length:491 Identity:91/491 - (18%)
Similarity:171/491 - (34%) Gaps:128/491 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAE 95
            :.|.:..::.:.....::::.|:.|||.|:.:.....|....:......:.:.|.|...   ..:
  Fly    14 IQTDEELERFMERPGLLVLDVYSEWCGPCQGMVGSLRKIKLDVGGDNLHLAICKSDTIT---ALK 75

  Fly    96 QYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTK-------KTGPPA----KDLTSVADAEQF 149
            ::..|..|...|...|..|....|.....:::.:.|       |:..|.    .:|..:...:|.
  Fly    76 RFNKRSEPIWLFVTGGRAVNLLFGSDVPKLVSLLVKELEKTMQKSSRPGTYRLDELQPIEVEQQR 140

  Fly   150 LKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKS 214
            :|...|.        .:|.|:...|....:|.    ::...|.|.: ...|.||.:|.|      
  Fly   141 IKMEAIE--------RAERAEREIKHKKQIDY----LNHVTDSIME-NMPDIGVTVFGP------ 186

  Fly   215 VFEGELNEENLKKFAQ-VQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYV------ 272
                ::|.:..||..: .::|.:               ..|...:..||.:...|..:.      
  Fly   187 ----QVNRDMFKKLTEPAEALKM---------------QCKDRRVIQVSTDQFEIVNFACKNPMP 232

  Fly   273 -DPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYK--PESDDL 334
             |.::::..|   ::|......||...|            ||.: |:....::.|.:  |.:||:
  Fly   233 PDVIEQLDGK---ELLMCFWKIDESIGT------------VPNV-LMAYAHELTKERVAPPNDDI 281

  Fly   335 SAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGH 399
            ..|.:...|...:  |||..:..:| .|.|.:.     :||. |...|.::||.         ..
  Fly   282 PEEHVIPPLITTM--KLKVEVELKE-GETWVEE-----ISSE-EEARLHQAKSK---------AK 328

  Fly   400 CKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESI-------KISSFPTIKYFRKEDNKVIDFN 457
            .|.::.....|||     |:......:..|:|.|::       .:...|::..|..|        
  Fly   329 TKSISHEEAHLAE-----EEAADLDAEEEASEEETVMPEPGGDAMGGLPSMPGFELE-------- 380

  Fly   458 LDRTLDDFVKFLDANGEVADSEPVEETEEEEEAPKK 493
                    ::.:|..||  |.|.|:|.:|||  |.|
  Fly   381 --------IEPVDEAGE--DEEEVQEIKEEE--PSK 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 80/470 (17%)
pdi_dom 33..133 CDD:273454 16/106 (15%)
PDI_b_family 137..231 CDD:239279 18/98 (18%)
PDI_b'_family 244..347 CDD:239280 19/111 (17%)
PDI_a_PDI_a'_C 368..469 CDD:239293 17/107 (16%)
CG18130NP_572772.1 TRX_NDPK 11..112 CDD:239246 15/100 (15%)
DUF4746 234..556 CDD:292550 50/230 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.