DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and prtp

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster


Alignment Length:501 Identity:114/501 - (22%)
Similarity:203/501 - (40%) Gaps:140/501 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICALFLA--ASYVAASAEAEVKVEEGVLVATVD--NFKQLIADNEFVLVEFYAPWCGHCKALAPE 65
            :|.|.|:  .....||.|.:...::......:|  .|...||... |.|:|:||||||||.:.|.
  Fly    11 VCGLLLSPLLPITRASQEEDTGKQDKQFTVELDPETFDTAIAGGN-VFVKFFAPWCGHCKRIQPL 74

  Fly    66 YAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSG--SPVEYSGGRQAADIIAW 128
            :.:.|:.:......:.:||||.|....|...:.|.|||||:.|:.|  ..|::.|.|....|..:
  Fly    75 WEQLAEIMNVDNPKVIIAKVDCTKHQGLCATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDF 139

  Fly   129 VTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVI 193
            :.|:...||:                                                   ||: 
  Fly   140 INKELSAPAE---------------------------------------------------ADL- 152

  Fly   194 AKYEAKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPL--IVDFNHESASKIFGGSIKSH 256
                                    ||:..|      ||::|.:  :||...::.:|..  |..:|
  Fly   153 ------------------------GEVKRE------QVENLNIGKVVDLTEDTFAKHV--STGNH 185

  Fly   257 LLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRI------FEFFGMNKEEVPTI 315
            .:.|.:....|.::.....:::||:.   |...|::..:.|.|:.      ||..|     .||:
  Fly   186 FVKFFAPWCSHCQRLAPTWEDLAKEL---IKEPTVTISKIDCTQFRSICQDFEVKG-----YPTL 242

  Fly   316 RLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLK--------QHLLSQELPEDWDK----NP 368
            ..|:..:.:.||. .:.|||  |::.:::|.:...|:        :.::.:|:..:.|.    .|
  Fly   243 LWIEDGKKIEKYS-GARDLS--TLKTYVEKMVGVPLEKTAGEAGDEKVVIEEVAGEEDAAKKLTP 304

  Fly   369 VKVLVSSNF-----ESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLA-EKYKDNEDIVIAKMDS 427
            .::.....|     |.||       .::|||||||||::|.|.::||| |.::....:.|||:|.
  Fly   305 QQLTGEDEFDQAIAEGVA-------FIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKVDC 362

  Fly   428 TANELESI----KISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 469
            ||.|.:.:    ::..:||: :..|...:..::...|:|.:...:|
  Fly   363 TAPENKQVCIDQQVEGYPTL-FLYKNGQRQNEYEGSRSLPELQAYL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 108/477 (23%)
pdi_dom 33..133 CDD:273454 36/103 (35%)
PDI_b_family 137..231 CDD:239279 6/93 (6%)
PDI_b'_family 244..347 CDD:239280 24/108 (22%)
PDI_a_PDI_a'_C 368..469 CDD:239293 32/110 (29%)
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 35/102 (34%)
ER_PDI_fam 39..409 CDD:273457 108/473 (23%)
PDI_a_ERp46 167..267 CDD:239303 25/112 (22%)
PDI_a_ERp46 303..407 CDD:239303 32/111 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463715
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.