DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and TrxT

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster


Alignment Length:143 Identity:37/143 - (25%)
Similarity:71/143 - (49%) Gaps:13/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VATVDNFKQ--LIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGEL 93
            |...|:..|  ::|:::.|:::|||.|||.||.:||:..:.|||.:::   :.:.||:.....::
  Fly     5 VRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDR---VVVLKVNVDENEDI 66

  Fly    94 AEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAII 158
            ..:|.|...||..|.:.|:.:|...|..:..:...:.|..|....:   .||.:....|.|..: 
  Fly    67 TVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHAGVYTDE---AADVKAVHIDGECIV- 127

  Fly   159 GFFKDLESEEAKT 171
                ||.:|.:::
  Fly   128 ----DLTAESSES 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 37/143 (26%)
pdi_dom 33..133 CDD:273454 28/101 (28%)
PDI_b_family 137..231 CDD:239279 7/35 (20%)
PDI_b'_family 244..347 CDD:239280
PDI_a_PDI_a'_C 368..469 CDD:239293
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 26/94 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.