DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and Erp44

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001008318.1 Gene:Erp44 / 298066 RGDID:1309176 Length:406 Species:Rattus norvegicus


Alignment Length:391 Identity:93/391 - (23%)
Similarity:168/391 - (42%) Gaps:80/391 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LICALFLAASYVAASAEAEVKVEEGVLVATVD--NFKQLIADNEFVLVEFYAPWCGHCKALAPEY 66
            |.|:|.|..:.:.|...||        :|::|  |..:::.:.:..||.|||.||...:.|.|.:
  Rat    12 LRCSLLLLVTSIFAPITAE--------IASLDSENIDEILNNADVALVNFYADWCRFSQMLHPIF 68

  Fly    67 AKAAQQLAEK---ESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPV--EYSGGRQAADII 126
            .:|:..:.|:   ::.:..|:||.....::|::|.:..|||||.||:|..:  ||.|.|....:.
  Rat    69 EEASDVIKEEYPDKNQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALA 133

  Fly   127 AWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNAD 191
            .::.::...|..::.|: |....|..::..|||:|:..:|:..:.|.:||:.|......:|:..|
  Rat   134 DYIRQQKSNPVHEIQSL-DEVTNLDRSKRNIIGYFEQKDSDNYRVFERVASILHDDCAFLSAFGD 197

  Fly   192 VIAKYEAKDNGVVLFKP----------------FD-------DKKSVFEGELNEENLKKFAQVQS 233
             ::|.|......:::||                ||       ||......|:..||.::..: :.
  Rat   198 -LSKPERYSGDNLIYKPPGRSVPDMVYLGSMTNFDVTFNWIQDKCVPLVREITFENGEELTE-EG 260

  Fly   234 LPLIVDFNHE---SASKIFGGSIKSHLLFFVSREG------GHIEKYVDPLKEIAKKYRDDILFV 289
            ||.::.|:.:   .:.:||...:...|   :|.:|      ...:|:..||..|.|...|   ..
  Rat   261 LPFLILFHMKEDTESLEIFQNEVARQL---ISEKGTINFLHADCDKFRHPLLHIQKTPAD---CP 319

  Fly   290 TISSDEEDHTRIFEFF------GMNKEEVPTIRLIKL------------------EEDMAKYKPE 330
            .|:.|...|..:|..|      |..|:.|..:...||                  ::|:|...||
  Rat   320 VIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQDQDVASSPPE 384

  Fly   331 S 331
            |
  Rat   385 S 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 86/368 (23%)
pdi_dom 33..133 CDD:273454 30/106 (28%)
PDI_b_family 137..231 CDD:239279 25/116 (22%)
PDI_b'_family 244..347 CDD:239280 26/118 (22%)
PDI_a_PDI_a'_C 368..469 CDD:239293
Erp44NP_001008318.1 PDI_a_ERp44 29..136 CDD:239294 33/114 (29%)
PDI_b_ERp44 144..234 CDD:239368 20/91 (22%)
Thioredoxin_6 167..350 CDD:290560 41/190 (22%)
PDI_b'_ERp44 245..355 CDD:239370 25/116 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.