DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and Erp27

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001100095.1 Gene:Erp27 / 297698 RGDID:1565381 Length:272 Species:Rattus norvegicus


Alignment Length:240 Identity:56/240 - (23%)
Similarity:121/240 - (50%) Gaps:12/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GPPAKD--LTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKY 196
            |.|.:.  ||.:....:.:...|:|:||||:|||......|..:|.......||:|::::|:..|
  Rat    35 GTPREPRWLTDIPATVELIAAAEVAVIGFFQDLEIPIVSIFRSMAQQFQDVSFGISNHSEVLTHY 99

  Fly   197 EAKDNGVVLFKPFDDKKSVFEGE----LNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHL 257
            ....|.:.||:..|:|:...:.|    |:...|.:|..:.:|..:.:::....:.:|...:::||
  Rat   100 NVTSNSICLFRLVDNKQLRLDAEDIDDLDAAKLSRFIHLNNLHWVTEYSPMIGAGLFNTMVQTHL 164

  Fly   258 LFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEE 322
            |..:::.....|:.:...::.||.::..||||.:.|.:.::.::..:|.:.:.::|.:.:.:..:
  Rat   165 LLIMNKASPEYEESLRSYQKAAKLFQGQILFVLVDSGKRENGKVIAYFRLKESQLPALAIYESVD 229

  Fly   323 DMAKYKPES-DDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDK 366
            |  |:...: .:::.|.:::|...||.|.|   |..|:...|..|
  Rat   230 D--KWDALTITEVTVEKVQSFCNGFLKGML---LRDQKAENDSGK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 56/240 (23%)
pdi_dom 33..133 CDD:273454
PDI_b_family 137..231 CDD:239279 27/99 (27%)
PDI_b'_family 244..347 CDD:239280 18/103 (17%)
PDI_a_PDI_a'_C 368..469 CDD:239293
Erp27NP_001100095.1 PDI_b_family 43..139 CDD:239279 27/95 (28%)
Thioredoxin_6 64..250 CDD:290560 39/187 (21%)
PDI_b'_family 156..253 CDD:239280 18/98 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350308
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18929
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.910

Return to query results.
Submit another query.