DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and Pdia6

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001004442.1 Gene:Pdia6 / 286906 RGDID:628688 Length:445 Species:Rattus norvegicus


Alignment Length:498 Identity:114/498 - (22%)
Similarity:167/498 - (33%) Gaps:229/498 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CALFLAASYVAASAEAEVKVEEGVLVATVDNF-KQLIADNEFVLVEFYAPWCGHCKALAPEYAKA 69
            |..|||.|.:.:|:       :.|:..|..|| :::|..:...||||||||||||:.|.||:.||
  Rat    16 CTFFLAVSALYSSS-------DDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKA 73

  Fly    70 AQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFF--RSGSPVEYSGGRQAADIIAWVTKK 132
            |..|   :..:|:..|:|.....|..||.|:|:||:|.|  ....|.:|.|||            
  Rat    74 ASAL---KDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGR------------ 123

  Fly   133 TGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYE 197
            ||....| .:::...|.:||.                                            
  Rat   124 TGEAIVD-AALSALRQLVKDR-------------------------------------------- 143

  Fly   198 AKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVS 262
                                                               .||           
  Rat   144 ---------------------------------------------------LGG----------- 146

  Fly   263 REGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKY 327
            |.||:         ...|:.|.|      ||.::|                   :::|.:|    
  Rat   147 RSGGY---------SSGKQGRGD------SSSKKD-------------------VVELTDD---- 173

  Fly   328 KPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEF 392
                                               .:|||             .||.....:|||
  Rat   174 -----------------------------------TFDKN-------------VLDSEDVWMVEF 190

  Fly   393 YAPWCGHCKQLAPIYDQLAEKYKDNE--DIVIAKMDSTANELESIK--ISSFPTIKYFRKEDNKV 453
            |||||||||.|.|.:...|.:.|:..  .:.:|.:|:|.|::.:.:  |..|||||.|:|.::.|
  Rat   191 YAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQVLASRYGIKGFPTIKIFQKGESPV 255

  Fly   454 IDFNLDRTLDDFV-KFLDANGEVADSEPVEETEE--EEEAPKK 493
             |::..||..|.| :.||.   .:|:.|..|..|  .|:..||
  Rat   256 -DYDGGRTRSDIVSRALDL---FSDNAPPPELLEIINEDIAKK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 101/454 (22%)
pdi_dom 33..133 CDD:273454 40/102 (39%)
PDI_b_family 137..231 CDD:239279 4/93 (4%)
PDI_b'_family 244..347 CDD:239280 13/102 (13%)
PDI_a_PDI_a'_C 368..469 CDD:239293 36/105 (34%)
Pdia6NP_001004442.1 PDI_a_P5 31..133 CDD:239299 44/117 (38%)
PDI_a_P5 166..271 CDD:239299 42/176 (24%)
P5_C 280..409 CDD:239281 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.