DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and SPAC13F5.05

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_593653.1 Gene:SPAC13F5.05 / 2542841 PomBaseID:SPAC13F5.05 Length:363 Species:Schizosaccharomyces pombe


Alignment Length:355 Identity:87/355 - (24%)
Similarity:145/355 - (40%) Gaps:64/355 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVR 100
            ||::.:......||.|||||||:||.|.|.|.|.|..| ....|:.....||.....:..||.|:
pombe    40 NFRKFVKAKGPSLVVFYAPWCGYCKKLVPTYQKLASNL-HSLLPVTAVDCDADQNRAVCSQYQVQ 103

  Fly   101 GYPTLKFF------RSGSPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKD--NEIAI 157
            |:||:|..      .|.|..:|:|.|....:..:|:.......|.|||.|..::|::|  |...:
pombe   104 GFPTIKLVYPSSKGSSLSSTDYNGDRSYKSLQKFVSDSIPSKVKILTSEAKTQKFIQDAQNSSKV 168

  Fly   158 IGFFKDLESEEAK---TFTKVANALDSFVF-------GVSSNADVIAKYEAKDNGVVLFKPFDDK 212
            |     |.|::.|   .:..::|...|..|       .|:...::.|..:..|..::..|..::.
pombe   169 I-----LISQKMKPTLLYKSLSNEFSSLPFSFMPAKANVNDLFNISAYVDTSDLPILFIKHPNNG 228

  Fly   213 KSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHI-------EK 270
            .|.|...||.:::.:|.|               |.|...:...:|..|.|::...|       :.
pombe   229 TSFFSNSLNRDSIVEFLQ---------------SSIKDNNFSEYLATFCSKKSCIITIQDKDSDS 278

  Fly   271 YVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKY-KPESDDL 334
            .:|  :.|.||| ..:.||.:..:.....|:.:...:...:...:.|.|...:...| ||     
pombe   279 GID--ESIRKKY-PKLHFVRLGRNTTVAERLEDTLDLGYSDTFLLSLKKSHYNAKPYGKP----- 335

  Fly   335 SAETIEAFLKKFL-DGKLKQHLLSQELPED 363
                    |:::| |.:::|...|..||.|
pombe   336 --------LRRWLEDIQVQQAGPSVSLPND 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 87/355 (25%)
pdi_dom 33..133 CDD:273454 35/102 (34%)
PDI_b_family 137..231 CDD:239279 24/105 (23%)
PDI_b'_family 244..347 CDD:239280 20/110 (18%)
PDI_a_PDI_a'_C 368..469 CDD:239293
SPAC13F5.05NP_593653.1 PDI_a_MPD1_like 32..139 CDD:239300 34/99 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.