DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and SPAC17H9.14c

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_593584.1 Gene:SPAC17H9.14c / 2542270 PomBaseID:SPAC17H9.14c Length:359 Species:Schizosaccharomyces pombe


Alignment Length:478 Identity:96/478 - (20%)
Similarity:155/478 - (32%) Gaps:245/478 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLICALFLAASYVAASAEAEVKVEEGVLVATVDNFKQLI-ADNEFVLVEFYAPWCGHCKALAP 64
            :.|:|.|||   :.|.||...|::        :::..:..| |..:..|:||||.||||||:|||
pombe     6 LSFVIFALF---ALVFASGVVELQ--------SLNELENTIRASKKGALIEFYATWCGHCKSLAP 59

  Fly    65 EYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFF-RSGS-PVEYSGGRQAADIIA 127
            .|.:.. .|.|..:.:.:.|:||....::|::|.:.|:|||.:| ..|| ||:||..|....:..
pombe    60 VYEELG-ALFEDHNDVLIGKIDADTHSDVADKYHITGFPTLIWFPPDGSEPVQYSNARDVDSLTQ 123

  Fly   128 WVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADV 192
            :|::|||               :|..:|.                                    
pombe   124 FVSEKTG---------------IKKRKIV------------------------------------ 137

  Fly   193 IAKYEAKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHL 257
                                                                             
pombe   138 ----------------------------------------------------------------- 137

  Fly   258 LFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEE 322
                                                                             
pombe   138 ----------------------------------------------------------------- 137

  Fly   323 DMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKS 387
                                                 ||.:     |..|.|.||:.|.:|..|.
pombe   138 -------------------------------------LPSN-----VVELDSLNFDKVVMDDKKD 160

  Fly   388 VLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESI----KISSFPTIKYFRK 448
            |||||||.|||:||:|||.|:.|.:.:|:..::.|.|::  |:....|    :::||||||:|.|
pombe   161 VLVEFYADWCGYCKRLAPTYETLGKVFKNEPNVEIVKIN--ADVFADIGRLHEVASFPTIKFFPK 223

  Fly   449 ED-NKVIDFNLDRTLDDFVKFLD 470
            :| :|...:..||:|:..:::::
pombe   224 DDKDKPELYEGDRSLESLIEYIN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 87/452 (19%)
pdi_dom 33..133 CDD:273454 37/102 (36%)
PDI_b_family 137..231 CDD:239279 2/93 (2%)
PDI_b'_family 244..347 CDD:239280 0/102 (0%)
PDI_a_PDI_a'_C 368..469 CDD:239293 43/105 (41%)
SPAC17H9.14cNP_593584.1 PDI_a_ERp38 21..125 CDD:239296 37/112 (33%)
Thioredoxin_6 55..247 CDD:290560 75/418 (18%)
PDI_a_ERp38 141..245 CDD:239296 43/110 (39%)
ERp29 265..354 CDD:285048
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.