DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and Txndc2

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001139474.1 Gene:Txndc2 / 213272 MGIID:2389312 Length:550 Species:Mus musculus


Alignment Length:349 Identity:82/349 - (23%)
Similarity:131/349 - (37%) Gaps:109/349 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 KKTGPPAKDLTSVADAE----QFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNAD 191
            ||...|.....||...|    :.|||:          ::|:|    |||.          .|..|
Mouse   294 KKEDRPKSSEDSVQSKEGEVHKPLKDS----------IQSKE----TKVP----------KSPQD 334

  Fly   192 VIAKYEAKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSH 256
            .|...|.|.:     :|..|.   .:.:.:||.......:||       ..:...|....||.  
Mouse   335 SIQSKEDKTH-----RPLKDS---VQSKESEEPKSSHESIQS-------KEDKIHKPLKDSIP-- 382

  Fly   257 LLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLE 321
                 |:||           :|.|...|     ||.|.||  ....|...:..:|..||:  ..|
Mouse   383 -----SKEG-----------DIPKSPED-----TIQSQEE--ITASEEDTIQSQEGNTIK--SSE 422

  Fly   322 EDMAKYKPESDDLSA--ETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDK 384
            ||:...:.:...|.|  ||:|..|.:.:..|                        ..||.|..|.
Mouse   423 EDVQLSESKLLGLGAEIETLEEGLVRVIKDK------------------------EEFEEVLKDA 463

  Fly   385 -SKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANE--LESIKISSFPTIKYF 446
             .|.|.|:|.|.|||.|:.:.|::..|:.|:   ||::..::|:...|  ::..:|...||.:::
Mouse   464 GEKLVAVDFSAAWCGPCRMMKPLFHSLSLKH---EDVIFLEVDTEDCEQLVQDCEIFHLPTFQFY 525

  Fly   447 RKEDNKVIDFN------LDRTLDD 464
            :.|: ||.:|:      |:|::.:
Mouse   526 KNEE-KVGEFSGALVGKLERSISE 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 82/349 (23%)
pdi_dom 33..133 CDD:273454 1/1 (100%)
PDI_b_family 137..231 CDD:239279 20/97 (21%)
PDI_b'_family 244..347 CDD:239280 27/104 (26%)
PDI_a_PDI_a'_C 368..469 CDD:239293 29/106 (27%)
Txndc2NP_001139474.1 TRX_family 454..546 CDD:239245 29/95 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.