powered by:
Protein Alignment Pdi and trx-4
DIOPT Version :9
Sequence 1: | NP_001287070.1 |
Gene: | Pdi / 39651 |
FlyBaseID: | FBgn0286818 |
Length: | 496 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_491142.1 |
Gene: | trx-4 / 189905 |
WormBaseID: | WBGene00021548 |
Length: | 107 |
Species: | Caenorhabditis elegans |
Alignment Length: | 67 |
Identity: | 22/67 - (32%) |
Similarity: | 39/67 - (58%) |
Gaps: | 1/67 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 377 FESV-ALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSF 440
|::: |..|::.|::.|.|.|||.|:.:.|..::||.::||...|:...:|......|..:|:|.
Worm 11 FKTIFAEKKTQPVILFFTASWCGPCQMIKPRVEELAAEHKDRLSILKIDVDECDGVGEEYEINSM 75
Fly 441 PT 442
||
Worm 76 PT 77
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.