DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and erp-44.3

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_501357.3 Gene:erp-44.3 / 185676 WormBaseID:WBGene00018358 Length:434 Species:Caenorhabditis elegans


Alignment Length:495 Identity:99/495 - (20%)
Similarity:168/495 - (33%) Gaps:169/495 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKL--AKVDATVEGELAE 95
            |..|..::|.::....|.|.|.||...:.|...:::||.....|....|.  ..||...|..|..
 Worm    51 TSTNHDEIIQNSRLTFVAFTASWCPFSRKLMSSFSQAAADYQAKYPDRKTVWGNVDCMAEDYLMN 115

  Fly    96 QYAVRGYPTLK-FFRSGSPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIG 159
            :|::..:||:| ||......||.|.||...:|.::.|                   .:|..:::.
 Worm   116 KYSITKFPTMKVFFYGYMMTEYRGSRQVKGLIEYIEK-------------------MENTSSLVN 161

  Fly   160 FFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDNGVVLF------KPFDDKKSVFEG 218
            .      .||::.|:..|                  |.....|.::.      .||         
 Worm   162 L------NEAESLTQWQN------------------YVIPQKGTLILWFPRGSPPF--------- 193

  Fly   219 ELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKY---VDPLKEIA- 279
               |..||..|.:.|..::|....|:..|     .:.|.|:| |.:|.|:|::   |...|||. 
 Worm   194 ---ELILKAIALIHSQLVVVVPISENLLK-----HEDHQLWF-SLDGEHVERFEGSVSNFKEIVE 249

  Fly   280 ---KKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYK----PESDDLSAE 337
               ||....:..:|..:.||          |.::..|.:.|::.::|:...|    ....:|..:
 Worm   250 WIKKKSAGMVRELTFENMEE----------MVEDGKPLLILLRKKDDIETEKQFVTTIRRELDQD 304

  Fly   338 TIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVE-----FYAPWC 397
            |:........|||                  |...|..:|.. .||....:|::     |.:||.
 Worm   305 TLLKLAPVMADGK------------------VLTAVLRHFNK-GLDDLPFLLIDQFTHSFPSPWK 350

  Fly   398 -------GHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVID 455
                   |:.||.      :|:.:.||                           :.||       
 Worm   351 GNEIFAEGNIKQF------VADLFNDN---------------------------HHRK------- 375

  Fly   456 FNLDRTLDDFVKFLDANGEVADSEPVEETEEEEEAPKKDE 495
              |...|::.::.:     |.::|.:|:...||:..|..|
 Worm   376 --LHEKLNELIQKI-----VTETEEIEKQASEEKVEKPTE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 92/472 (19%)
pdi_dom 33..133 CDD:273454 30/102 (29%)
PDI_b_family 137..231 CDD:239279 13/99 (13%)
PDI_b'_family 244..347 CDD:239280 24/113 (21%)
PDI_a_PDI_a'_C 368..469 CDD:239293 19/112 (17%)
erp-44.3NP_501357.3 Thioredoxin_like 45..150 CDD:381987 29/98 (30%)
Thioredoxin_like 259..369 CDD:381987 26/144 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.