DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and pdi-6

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_509190.1 Gene:pdi-6 / 180974 WormBaseID:WBGene00015168 Length:440 Species:Caenorhabditis elegans


Alignment Length:500 Identity:110/500 - (22%)
Similarity:161/500 - (32%) Gaps:220/500 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAASYVAASAEAEVKVEEGVLVATVDNFK-QLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQL 73
            |.||....|.......::.|:..|..||: ::|..::..:||||||||||||:|.|||.|||..|
 Worm     7 LLASLAITSVCGMYSKKDDVVELTEANFQSKVINSDDIWIVEFYAPWCGHCKSLVPEYKKAASAL 71

  Fly    74 AEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSG--SPVEYSGGRQAADIIAWVTKKTGPP 136
               :...|:..||.|....:...|.|:|:||||.|.:.  .|.:|:|.|.|              
 Worm    72 ---KGVAKVGAVDMTQHQSVGGPYNVQGFPTLKIFGADKKKPTDYNGQRTA-------------- 119

  Fly   137 AKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDN 201
                       |.:.|:.:|        |:::|                      |.|:...|.:
 Worm   120 -----------QAIADSVLA--------EAKKA----------------------VSARLGGKSS 143

  Fly   202 GVVLFKPFDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGG 266
            |                                        .|:|....||.|        |.||
 Worm   144 G----------------------------------------SSSSGSGSGSGK--------RGGG 160

  Fly   267 HIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKPES 331
                                                   |...|.|.                  
 Worm   161 ---------------------------------------GSGNEVVE------------------ 168

  Fly   332 DDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPW 396
                                                    |..:|||.:.|:.....||||:|||
 Worm   169 ----------------------------------------LTDANFEDLVLNSKDIWLVEFFAPW 193

  Fly   397 CGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIK--ISSFPTIKYFR--KEDNKVIDFN 457
            |||||.|.|.:...|.:.|..  :.:..:|:|.:.:.:.|  |..|||||||.  .:.:...|::
 Worm   194 CGHCKSLEPQWKAAASELKGK--VRLGALDATVHTVVANKFAIRGFPTIKYFAPGSDVSDAQDYD 256

  Fly   458 LDRTLDDFVKFLDANGEVADSEPVEETEE------EEEAPKKDEL 496
            ..|...|.|.:..|..:  ::.|..|..|      .|:|.|:.:|
 Worm   257 GGRQSSDIVAWASARAQ--ENMPAPEVFEGINQQVVEDACKEKQL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 99/453 (22%)
pdi_dom 33..133 CDD:273454 41/102 (40%)
PDI_b_family 137..231 CDD:239279 9/93 (10%)
PDI_b'_family 244..347 CDD:239280 11/102 (11%)
PDI_a_PDI_a'_C 368..469 CDD:239293 36/104 (35%)
pdi-6NP_509190.1 PDI_a_P5 25..127 CDD:239299 44/129 (34%)
PDI_a_P5 165..269 CDD:239299 38/163 (23%)
P5_C 278..407 CDD:239281 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.