DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and erp-44.1

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001367560.1 Gene:erp-44.1 / 172191 WormBaseID:WBGene00016278 Length:411 Species:Caenorhabditis elegans


Alignment Length:445 Identity:106/445 - (23%)
Similarity:176/445 - (39%) Gaps:121/445 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LICALFLAASYVAASAEAEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAK 68
            |.|...|.|..|:.:::               ||:|.|..||.|.|.|||.||...:.|.|.:.:
 Worm    27 LFCPALLNAEVVSLTSQ---------------NFEQTIQANELVFVNFYADWCRFSQMLKPIFLE 76

  Fly    69 AAQQLAEKESPIKL--AKVDATVEGELAEQYAVRGYPTLKFFRSGSPV--EYSGGRQAADIIAWV 129
            |:::..: .:|.|:  |.|||....::|.:|.|..|||||.||:|...  ||...|....:..::
 Worm    77 ASEKFKD-AAPGKIMWASVDADKNNDIATKYHVNKYPTLKLFRNGEAAKREYRSSRSVEALSEFI 140

  Fly   130 TKKTGPPAKDLTSVADAEQFLKDNEI---------AIIGFFKDLESEEAKTFTKVANALD---SF 182
            .|:.....|         :|::.|.:         ..||:|.|..|.|.|....||....   .|
 Worm   141 NKQMEVTVK---------KFIEKNALQAAHNPEKNTFIGYFHDENSVEYKNLMNVAMFYRDECEF 196

  Fly   183 VFGVSSNADVIAKYEAKDNG---VVLFKPFDDKKSV------FEGEL-NEENLKKFAQVQSLPLI 237
            :.|:   .|:....||...|   .::|:|  ..|:|      |.|:. ..|.||::...:.:||:
 Worm   197 MVGI---GDLNFPGEAPAAGQPPKLVFQP--SNKAVNPAQIPFSGDFATYEYLKQWVADKCVPLV 256

  Fly   238 VDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIF 302
            .:...::|.::....:...:||         :|..|.:.|  |.:.|.|:               
 Worm   257 REITFQNAEELTEEGLPFMILF---------KKSDDKVSE--KIFTDAIV--------------- 295

  Fly   303 EFFGMNKEEVP----TIRLIKLEEDMAKY------KPESDDLSAETIEAF-----LKKFLD---- 348
                   .|:|    .|..:..:..:.|:      |.|| ||....|::|     .|.|.|    
 Worm   296 -------RELPDQRKAINCLVGDGTIFKHPLSHLGKSES-DLPVIAIDSFRHMYLFKNFEDVNVP 352

  Fly   349 GKLKQHLL---SQELPEDWDKNPVKVLVS---------SNFESVALDKSKSVLVE 391
            |||::.:|   |.:|..::...|..|..:         |.||.:....|:..:::
 Worm   353 GKLREFVLDLHSGKLHREFHHGPDPVTGNQAPDTEPPPSTFEKLKPASSRYTILD 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 101/422 (24%)
pdi_dom 33..133 CDD:273454 37/103 (36%)
PDI_b_family 137..231 CDD:239279 27/115 (23%)
PDI_b'_family 244..347 CDD:239280 21/117 (18%)
PDI_a_PDI_a'_C 368..469 CDD:239293 6/33 (18%)
erp-44.1NP_001367560.1 PDI_a_ERp44 35..140 CDD:239294 38/120 (32%)
PDI_b_ERp44 148..245 CDD:239368 25/110 (23%)
PDI_b'_ERp44 256..366 CDD:239370 28/143 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.