DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and ZK973.11

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_491361.1 Gene:ZK973.11 / 172039 WormBaseID:WBGene00022836 Length:447 Species:Caenorhabditis elegans


Alignment Length:494 Identity:116/494 - (23%)
Similarity:186/494 - (37%) Gaps:141/494 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTL 105
            :.|.....||||||||.|||.|.|.:.:....|::...||::.|:|.|....:|.:.:::||||:
 Worm    40 VKDEGMWFVEFYAPWCAHCKRLHPVWDQVGHTLSDSNLPIRVGKLDCTRFPAVANKLSIQGYPTI 104

  Fly   106 KFFRSGSPVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAK 170
            .|||:|..::|.|||:...::::..:...|          ..:.:.:|:|..:..  ...|:.:.
 Worm   105 LFFRNGHVIDYRGGREKEALVSFAKRCAAP----------IIEVINENQIEKVKL--SARSQPSY 157

  Fly   171 TF--TKVANALDSFVFGVSSNADVIAKYEA--KDNG------VVLFKPFDDKKSVFEGELNEENL 225
            .|  |......|:|....||...|...|..  .:|.      |.:||  |:.:..|.|::  |.|
 Worm   158 VFFGTSSGPLFDAFNEAASSKFSVARFYSVAPPENDASFRQRVAVFK--DNFEIEFNGDI--EKL 218

  Fly   226 KKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAK---------- 280
            .::...:..|..:.....:.::| |.|.|  |:..|.....|......|::|..|          
 Worm   219 TEWVTRERWPGFLQATSSNLAEI-GASGK--LVVLVVSSESHKFNNTSPIREFHKTAEEASKELR 280

  Fly   281 KYRD-------------DILF-VTISSDEEDHTRIFEFFGMN---KEEVPTIRLIK-----LEED 323
            |:.|             |:.. :.:::..|.|..||.:....   .|:.|:...||     ||: 
 Worm   281 KHPDLWNRFQFAWLDGSDLASQIQMAAVSEPHLFIFNYTSYEYYLSEDEPSQMTIKSILTFLEQ- 344

  Fly   324 MAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSV 388
                  .|:.:..|||.||     .|:   |||:                          :.|.:
 Worm   345 ------TSEGIDKETIVAF-----GGR---HLLT--------------------------RIKRM 369

  Fly   389 LVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELES----IKISSFPTIKYFRKE 449
            ..|.|  |                        .||:|.:|...|.|    :.|:....|.|    
 Worm   370 AFELY--W------------------------NIAQMFATQPLLSSCLFGVPIAFLSIICY---- 404

  Fly   450 DNKVIDFNLDRTLDDFVKFLDANGEVADSEPVEETEEEE 488
            .....||.:||  |:|....|   |:.|.|..||||..|
 Worm   405 SICSADFTVDR--DEFYGDED---ELIDDEEGEETEHPE 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 108/478 (23%)
pdi_dom 33..133 CDD:273454 33/91 (36%)
PDI_b_family 137..231 CDD:239279 20/103 (19%)
PDI_b'_family 244..347 CDD:239280 29/134 (22%)
PDI_a_PDI_a'_C 368..469 CDD:239293 19/104 (18%)
ZK973.11NP_491361.1 ER_PDI_fam 29..>348 CDD:273457 79/333 (24%)
PDI_a_TMX3 29..132 CDD:239298 33/91 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.